CAZyme Information: ASPACDRAFT_1880973-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1880973-t33_1-p1
• CAZy Family: CE2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		52365.13	4.5435

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878977:460332-462083(+)

Full Sequence      

MKASTALAPLLGFLPEASGSNTTACCSALQATSLRDHVTFPNSVAYNESVTSYFAVNAQL
HPSCIVQPHTADDVSLAVSTLVQAGESQCKFAVRSGGHTTWAGAADIEQGVTIDLSMMNS
TTYHAGKGVASILPGSRWQAVYKALDPNGVTVPGGRGGPVGVGGFLIGGGNTFYTARVGF
ACDNVENFEVVLANGSVVNANRTSNSDLYKALKGGSINFGIVTNYDLKTLPHDGLWGGLV
VYDNSTTEQQISAAVNFVDNIHNDPYASWIGMWEYSSATGQNIIANALEYTKPVAYPAAF
DEFVAIKNTTDTMRFATIYNLTQELVQAEGYRDIFTTGTYRNDAEVLRKAIALHNENIEK
AKAEAQSESWSMDTIHTAAQGGNVLGLERFDENLVQVLYDYSWDDARDDALFTRLGRTAL
TDLDAYAQSIGAANEYIYLNYADQSQSPLSGYGEENVQFIAQVAKKYDPHGVFQTQVPGG
FKVSGVGV

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	57	475	1.3e-55	0.9694323144104804

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.02e-13	62	201	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	4.21e-13	62	270	32	240	FAD/FMN-containing dehydrogenase [Energy production and conversion].
178402	PLN02805	9.32e-05	55	228	130	303	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	8.78e-04	10	223	15	232	cytokinin dehydrogenase
411067	Arc1	0.004	336	410	1	62	Arc1, AvrRxo1-required chaperone. This family contains AvrRxo1-ORF2 (also called AvrRxo1-required chaperone or Arc1) which appears to act as a molecular chaperone for AvrRxo1-ORF1 (also called AvrRxo1), a type III-secreted virulence factor in Xanthomonas oryzae (Xoc), a bacteria that causes leaf streak (BLS) disease in rice plants. AvrRxo1-ORF1 delivery in rice plant cells is recognized by disease resistance protein Rxo1, which triggers resistance to BLS disease. In the Xoc genome, the Arc1 gene is found adjacent to AvrRxo1; Arc1 functions to suppress the bacteriostatic activity of AvrRxo1-ORF1 in bacterial cells. Arc1 has a kinase-binding domain with a structure that is atypical of effector-binding chaperones, while AvrRxo1 has a T4 polynucleotide kinase (T4pnk) domain. AvrRxo1 and Arc1 comprise a toxin-antitoxin system similar to members of the zeta-epsilon family, with Arc1 acting as the antitoxin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW22693.1|AA7	7.58e-22	4	270	5	269
QRD93627.1|AA7	1.14e-17	38	231	24	215
UDD63515.1|AA7	1.14e-17	38	231	24	215
QMW46638.1|AA7	3.65e-17	38	231	24	215
ANH22765.1|AA7	1.13e-16	48	284	106	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FYD_A	2.14e-17	35	226	19	205	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYF_A	3.80e-17	35	226	19	205	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYG_A	3.80e-17	35	226	19	205	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYE_A	5.07e-17	35	226	19	205	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYB_A	6.77e-17	35	226	19	205	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VPE5|SDCF_EMENI	1.06e-159	25	483	8	476	FAD-dependent monooxygenase sdcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sdcF PE=1 SV=1
sp|A0A0U5GQ05|DRTC_ASPCI	7.04e-123	25	488	44	518	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|M2T7Z1|TPCD_COCH5	1.41e-76	36	484	52	518	FAD-dependent monooxygenase tpcD OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) OX=701091 GN=tpcD PE=1 SV=1
sp|A0A2G5ICA0|CTB5_CERBT	3.03e-73	17	483	36	524	FAD-dependent monooxygenase CTB5 OS=Cercospora beticola OX=122368 GN=CTB5 PE=3 SV=1
sp|A0ST43|CTB5_CERNC	1.41e-64	52	483	3	456	FAD-dependent monooxygenase CTB5 OS=Cercospora nicotianae OX=29003 GN=CTB5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.896204	0.103825

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1880973-t33_1-p1.