CAZyme Information: ASPACDRAFT_1876912-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1876912-t33_1-p1
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	KV878991|CGC4	35667.01	4.0020

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878991:248717-249969(-)

Full Sequence      

MVKSVLASALFAVSALAASRTTAPSGAIVVAKSGGDYTTIGDAIDALSTSTTDTQTIFIE
EGTYDEQVYLPAMTGKVIIYGQTENTDSYADNLVTITHAISYEDAGESDDLTATFRNKAV
GSQVYNLNIANTCGQACHQALAVSAWADQQGYYGCNFTGYQDTLLAQTGNQLYINSYIEG
AVDFIFGQHARAWFQNVDIRVVEGPTSASITANGRSSETDTSYYVINKSTVAAKEGDDVA
EGTYYLGRPWSEYARVVFQQTSMTNVINSLGWTEWSTSTPNTEYVTFGEYANTGAGSEGT
RASFAEKLDAKLTITDILGSDYTSWVDTSYF

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	310	6.6e-78	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.02e-52	28	297	2	266	Pectinesterase.
215179	PLN02314	2.54e-44	21	322	273	574	pectinesterase
178346	PLN02745	1.29e-43	16	300	275	554	Putative pectinesterase/pectinesterase inhibitor
178051	PLN02432	1.80e-41	17	297	2	260	putative pectinesterase
178504	PLN02916	2.75e-40	16	301	177	460	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAB42153.1|CE8|3.1.1.11	3.19e-236	1	331	1	331
CAA02202.1|CE8|3.1.1.11	2.14e-172	1	330	1	329
CAA02198.1|CE8|3.1.1.11	2.14e-172	1	330	1	329
AKA88527.1|CE8	2.14e-172	1	330	1	329
CAA37084.1|CE8|3.1.1.11	2.14e-172	1	330	1	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	4.17e-71	19	330	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.89e-71	19	330	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	6.71e-38	19	297	2	273	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.11e-28	29	297	6	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.48e-13	34	297	45	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	5.67e-237	1	331	1	331	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	3.79e-173	1	330	1	329	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q2UBD9|PMEA_ASPOR	6.28e-76	20	330	28	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	1.77e-75	20	330	28	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.27e-72	19	330	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000399	0.999561	CS pos: 20-21. Pr: 0.5075

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1876912-t33_1-p1.