CAZyme Information: ASPACDRAFT_1864575-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1864575-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675		73751.09	5.1239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878972:941017-943144(-)

Full Sequence      

MRWLPSLLGAIALLPLSEATSCWRNTTCSGPTTAAFPGSWEKNIFAPASRTVNPETLFLI
TKPDVTHEYAQYKLQGNGSLVVYDFGREVGGIVTVKYTSTGSGALGLAFTEAKDYIGEWS
DSSNGGFKGPDGALYGNFTEAGEHSYTMPDKYLRGGFRYLTLFLITDNSTAVQIKDVSLE
IGFQPTWSNLRAYQGYFDSSDDLLNAIWYSGAYTLQTNEVPVNTGRQIPAMPAGWANNAT
LGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSIGNLESVKNALQVMYNYQASTGAFDES
GPPLSQKNSDTYHMWSMVGTYNYLLYTNDTDFLETNWAGYQKAMEYIYGKVTYASGLLNV
TGTRDWARWQQGYNNTEAQMILYHTLKTGAELATWAGDTTGLSDTYTTRAEKLREAINEY
CWDDSYGAFKDNATDTTLHPQDANSMALLFGVVDSERAASISEKLTENWTPIGAVAPELP
ENISPFISSFEIQGHFTVGQPARALELIRRSWGWYYNNENGTQSTVIEGYLQNGTFGYRS
SRGYYYDTAYVSHAHGWSSGPTSALTNYIVGLTVTSPVGATWKLAPQFGDLKTAQAGFTT
SLGQFQASWTKQSNEYSLQFTVPKGTTGSLALPYLNSKKPTITIDGKKITKGVSYANNTA
TVAVASGGSHKVVVK

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	80	631	4.3e-99	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.00e-12	195	467	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	3.35e-06	576	633	3	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407295	Glyco_hydro_36	3.20e-04	313	572	128	424	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
225942	GDB1	0.001	234	468	259	508	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
283786	GDE_C	0.002	259	473	31	268	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43282.1|GH78	0.0	1	662	1	623
UCK57529.1|GH78	0.0	4	674	10	685
QRD88907.1|GH78	0.0	4	674	10	685
BAU45349.1|GH78|3.2.1.174	0.0	1	674	4	679
QMW37218.1|GH78	0.0	4	674	7	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.49e-19	81	603	194	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPACDRAFT_1864575-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000279	0.999670	CS pos: 19-20. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1864575-t33_1-p1.