CAZyme Information: ASPACDRAFT_1861710-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1861710-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772		87082.23	7.9576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878970:1870759-1873189(-)

Full Sequence      

MTMQGQFANLERWPKEDIVYVSVLGPLLVAALLEWILFLAAFIYCLVKVYQKADHWSIKV
LAVVMILLFTFLRGMFFPVMIAILPLPTQITRYFPTRLTSVLQWFAFWTFSVLLVIPWLF
CVNQLIINSLGRTKRVKQALDDRTAPKTVIVMPVFKEEPHILIKAIDSVVSSDYPAYCIH
VFLSYDGGQIDESYLQVIQHLGIPISLETYPQSIDVTYKGARITVSRFKHGGKRHCQKQT
FRLIDKVYADYLRRHDDLFLLFIDSDCIVDKLCLQNFMYDMELKPGSKHNMLAMTGILTS
TTAKNSLITVLQDMEYVHGQLFERSVESGCGAVTCLPGALTILRFSAFRKMAKYYFADKA
EQCEDLFDYGKCHLGEDRWLTHLFMIGAAERYQIQMCTGAFCKTEAVQTFSSLLKQRRRW
FLGFITNEVCMLTDARLWRRYPLLCLVRFMQNTIRTTALLFLILVVSLITTSSKIENLPV
GFIAISLGLNYLLMLYFGLKLKRFKAWLYPLMFIVNPFFNWLYMVYGIFTAGQRTWGGPR
ADAAKADEHTSPEEAVQKAREQGDELNVMVDTFRTKKDERGIPVRPSKKIHGRLSGAPPL
PHDYGDLPKQEDLESAMVKYMTPLPGVPRIGLHPSYSLESVATTDSGTNSICLPLPVESL
VKGQEQARPYHASGIPGYTNSAVDINTSYGPGVAVVGSRLPSAEGYESGIVHLSSDQAHA
AATYSTASDTIDEDADYRNVITTDGPGIKTPDACYDPLTQQYVSVPASAGLR

Enzyme Prediction     

EC	2.4.1.16:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	260	546	1.8e-24	0.5578747628083491

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	2.50e-24	229	420	50	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	2.86e-19	93	529	1	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	2.93e-16	259	540	204	493	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	7.02e-16	150	350	1	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404513	Glyco_trans_2_3	9.18e-08	259	466	1	189	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86377.1|GT2	0.0	13	672	13	672
CAK45501.1|GT2	0.0	72	673	44	643
BCR97215.1|GT2	0.0	65	668	1	602
BCS09682.1|GT2	0.0	10	668	10	615
QRD85025.1|GH106|GT2	0.0	13	726	1023	1731

PDB Hits     

ASPACDRAFT_1861710-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78746|CHSD_ASPFU	0.0	73	670	29	622	Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsD PE=3 SV=1
sp|O13395|CHS6_USTMA	8.74e-12	244	540	566	857	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|P78611|CHSD_EMENI	3.43e-11	260	603	847	1189	Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4
sp|J9VNT4|CHS5_CRYNH	1.50e-10	259	427	1419	1588	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|O13353|CHS4_MAGO7	5.30e-10	260	545	863	1155	Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CHS4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

Start	End
25	47
60	82
105	127
458	475
480	499
506	528