CAZyme Information: ASPACDRAFT_1858413-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1858413-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	KV878982|CGC10	92593.16	5.3778

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878982:875922-878483(+)

Full Sequence      

MHSDTPSSAVNQLLQSLTLEEKVALLAGKNMWETANINRLHIPSLKMTDGPAGARGSKWT
YGSLTTWIPCGVSLAATFDPALVEKVGAVLGQETRRKGCQVLLAPTMNLSRSPLGGRNFE
GYGEDPYLIGVMAIAMIRGIQSQGVGACMKHFILNDTETRRFNVDQTIDERTLREVYMKP
FSMAAQEPEAAPWTAMVSYPRINGLHADLSPDILPRLLRKELQYDRLVMSDWGGLNSTVE
SLLATTDLEMPGPPVRRGERLLAAIQAGRIDVATHVDPSVRRMLQLLEQTGLLNNRSDST
EVSSEQTTNDPAFHQIVREAAQSGLVLLKNESVLPLQPSRLRKIAIIGPNARKPTAGGAG
SAAVNPFYITTPEECLRNALRAANPGIKLTYRPGIRDSLRPALLGGQLTVPDGSRQGLHV
SFFAGHAFEGPVVATSLWDDSLIYLMSDGDIPAALEGRPYSYQAAGVVTSSETGRYTWSL
ANTGKAKLFLDDELLIDNSEWGVVTGGFLGCSSEDRTASTHLEAGRPYRLRVDNVVTLPL
FDAFDNTLFPRVSGVRVGLALERDETLMLEQAVDSAREADVAVVVVGHNKDSEGEGGDRA
HMQLPGHTDELVGAVCAANPNTVVVVQSASAVTMPWADAAAGIVMAWYQGQENGQALAQA
LLGHCNFSGKLPITFPQRLEDHGSSAWFPGEAAQDRNTFGEEVLVGYRHLDARGIPPLWS
FGFGLSYTRFELADIRISGTLSVVSSSENRVSVHARVLNVGVCDGQEVVQVYVAPSARLG
EMGLVSYPKTLAGLAKITVPARESREVTIIIPGSELRWYDVTTGQWRLDVGKYKCWVGRS
LCELDKELEIEVE

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_1858413-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	251	6.2e-62	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.88e-65	29	357	47	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.09e-43	10	838	38	751	beta-glucosidase BglX.
395747	Glyco_hydro_3	9.39e-38	38	286	62	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.82e-37	325	727	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	5.62e-27	13	852	56	779	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48047.1|GH3	0.0	2	852	3	853
BCS13433.1|GH3	0.0	7	852	8	853
BCS01725.1|GH3	0.0	7	852	44	889
QMW31943.1|GH3	0.0	8	852	7	851
QRD91011.1|GH3	0.0	8	852	9	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.87e-132	10	853	6	837	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.56e-127	10	853	6	837	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	7.30e-108	10	840	5	656	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	1.83e-92	7	852	51	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	4.80e-86	14	840	9	651	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	9.53e-161	10	852	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	1.92e-157	10	853	11	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q4WLY1|BGLJ_ASPFU	3.91e-147	9	833	13	837	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	1.09e-146	9	833	13	837	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	1.49e-146	4	833	8	836	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999980	0.000050

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1858413-t33_1-p1.