CAZyme Information: ASPACDRAFT_1853438-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1853438-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	KV878972|CGC12	46135.17	4.6173

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878972:943819-945279(+)

Full Sequence      

MRFSLTSASSLSLVLGLSALGYASNVQKKGNVCTVKANGHQKDDVPNLLEAFKECGNGGT
IIFPEDQSYWIGQRLNPVLNNVAIEWRGKWTFSDDLSYWRNHSYPVAFQNHAAGFVITGQ
NISINGYGTGGIDGNGNVWYTAEAGVTQPGRPMPFVFWNVSDVEVESFYVKDPPLWSLNI
MNGTNMRFNDITCNATAVDAPYGSNWVQNTDGFDTMDATNIQLTNFVYQGGDDCIAIKPR
SYNIDIQNVTCRGGNGIAVGSLGQYLEDSSVANIRVDNVKIIRYNEDMHNSAYIKTWVGA
LVPQDSYESDYLPRGDGWGSVKNIIFSNFDVQGANAGPSISESSGDNGSYAGTSKMLISN
IAFVNFTGYINTTKSTTSSVSCSKLYPCYNIEYDNVVLYPLNSTTPGKGSCSYTADGGVH
GLSGC

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_1853438-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	57	413	1.4e-61	0.9446153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	7.69e-35	116	368	47	275	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	4.01e-23	36	412	76	416	polygalacturonase ADPG
215540	PLN03010	8.88e-20	177	368	159	346	polygalacturonase
215426	PLN02793	2.67e-17	59	402	117	398	Probable polygalacturonase
178580	PLN03003	1.87e-16	128	368	119	329	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43283.1|GH28	5.86e-263	8	425	5	423
ABD61568.1|GH28	5.86e-263	8	425	5	423
BCR97806.1|GH28	3.38e-262	8	425	4	423
BCS10262.1|GH28	3.38e-262	8	425	4	423
QQK41591.1|GH28	1.85e-248	10	425	8	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.44e-34	32	350	18	310	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1NHC_A	1.22e-15	132	353	80	273	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
1HG8_A	1.18e-12	75	370	36	305	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAY7|RGXC_ASPNC	1.04e-263	8	425	5	423	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1
sp|A1D415|RGXC_NEOFI	1.13e-237	1	425	1	423	Putative galacturan 1,4-alpha-galacturonidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rgxC PE=3 SV=1
sp|Q2UP32|RGXA_ASPOR	1.18e-68	7	422	4	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	1.18e-68	7	422	4	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|A2QBB4|RGXA_ASPNC	1.85e-67	7	332	5	337	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000489	0.999488	CS pos: 23-24. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1853438-t33_1-p1.