CAZyme Information: ASPACDRAFT_1851404-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_1851404-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		56007.01	4.5872

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878970:395674-398450(-)

Full Sequence      

MNHIPPAAVFWKNTDPSAAFPQARFVQPVLRTEDKAQSRADAVKEAFSHAWDGYYQYAFP
HDELHPVSNGYGDSRNGWGASAVDALSTAVIMRNATIVNQILDHVAKIDYSSTSSTVSLF
ETTIRYLGGMLSGYDLLKGPAADLVDDSSKVDTLLTQSKNLGDVLKFAFDTPSGVPYNNL
NITSKGNDGATTNGLAVTGTLVLEWTRLSDLIGDSTYANLSQKAESYLLNPQPQSAEPFP
GLVGSNINIATGQFADGAVSWNGGADSYYEYLIKMYVYDPNRFETYKDRWVAAAESSMKH
LASHPSTRPDLTFLASYNNGKLGLSSQHLTCFDGGSFLLGGTVLDRSDLIDFGLELVNGC
HDTYNSTLTGIGPEAFSWDPNSVPSSQQSLFESAGFYITSGAYILRPEVIESFYYAWRVT
GQEIYREWIWSAFQSINKYCRTDSGFAGLTNVNAANGGNRYDNQESFMFAEVLKYSYLAF
APEDEWQVQKGSGNQFVLNTEAHPVKVYSS

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	46	507	1.7e-138	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	46	507	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.19e-124	2	507	29	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG17887.1|GH47	3.65e-315	16	510	18	513
CAK37306.1|GH47	3.65e-315	16	510	18	513
BCS05959.1|GH47	4.06e-312	16	510	18	513
BAA08634.1|GH47|3.2.1.113	9.53e-311	16	510	18	513
BAE57653.1|GH47|3.2.1.113	7.46e-298	16	507	18	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	1.34e-271	27	507	27	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	4.76e-270	37	507	3	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	5.56e-167	38	510	14	495	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	5.46e-67	43	507	26	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	6.80e-67	43	507	24	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QAS2|MNS1B_ASPNC	6.49e-316	16	510	18	513	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	1.69e-311	16	510	18	513	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|Q2ULB2|MNS1B_ASPOR	1.32e-298	16	507	18	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	1.32e-298	16	507	18	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|A1CP08|MNS1B_ASPCL	1.25e-294	3	510	2	511	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_1851404-t33_1-p1.