CAZyme Information: ASPACDRAFT_125011-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_125011-t33_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		40358.74	4.8538

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878985:30764-31870(-)

Full Sequence      

MISSRYLRFILLTVPFLSLIFLISQNWDEIPKPFSHSKSNASLGLSEAHPPPQSSANDNN
NNIQTEPTTLSTTFPSSNPHTVDAAIAGITDKVWHSSKTPELSADQIGWINSWLLKNPTF
RHELLTDGSALTFVHTRYGATRPDIVEVYEKLPIPILRADLLRYLIVLAEGGIWSDLDVT
CDTEVDAWVPPEYPSSNIDMIVGLEFDFGWRGEGTEVASQFCNWVFAARPGSRNLAAVVD
AVVAKLKEIAALNGVGVDQLTLEMLPVDVVNVTGPKIMTIALLNGLAGLLGRVVDDRDFH
GIKSPKLVGDLLIMPGNAFAAAQNGFPTDQSPALVSHHYAGSWKQADAEAKERKKLQEQQ
QQQEQQQG

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_125011-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	110	190	6.3e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.41e-19	76	207	72	198	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.62e-15	103	195	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46331.1|GT32	2.75e-149	3	353	59	409
BCS14453.1|GT32	4.66e-146	3	353	8	361
BCS02801.1|GT32	1.50e-145	3	353	42	395
QKX62870.1|GT32	1.73e-127	3	352	8	372
QQK48128.1|GT32	8.92e-123	3	353	9	349

PDB Hits     

ASPACDRAFT_125011-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	9.79e-32	87	344	140	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	3.82e-23	92	319	136	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	2.00e-19	112	344	126	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.21e-10	87	231	94	271	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.15e-09	84	204	55	174	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994286	0.005746

TMHMM  Annotations     

Start	End
7	24