CAZyme Information: ASPACDRAFT_124849-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_124849-t33_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	KV878984|CGC5	41406.03	4.3263

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878984:573405-574763(+)

Full Sequence      

MRQVLLPPLLLLLLGLEASASAWGPRKFTTLVTFGDSYTDDTRFAYFYTHNDSAPPVGWV
EPDANISASGGPTWPHYVSTFHEATKNRYNYAVAGATCSNDIVARAYDPTAGYLFPSVLD
YEVPAFTADAAYTDPNTNQRFLDIPADETVYAIWIGTNDLGNNAFLTDSQLNNATLVDYL
DCVYSALDGVYNATTTTGKSTQTERGASSGSRAAKYFVIMNVVPLQLAPLYATPENGGVG
PNNYWTDKPANLTEISGRMEGQVVLVNEAFRYRTPVEVLVKKRWPGVQVAVFDVYSLISE
IYYNPTQYLNGTAPANVTGFEYHCNINGTDCTKSDSPDSFLWFDQLHPSARTDQIIAEEF
IKVVSGESRFAEYWS

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	31	360	3.9e-68	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.98e-46	30	360	1	267	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	8.01e-11	90	361	79	312	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	2.42e-09	18	358	19	327	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	5.81e-09	28	358	1	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
178701	PLN03156	3.14e-05	281	364	260	346	GDSL esterase/lipase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15697.1|CE16	1.14e-158	12	375	10	355
BCS04097.1|CE16	1.14e-158	12	375	10	355
QMW44554.1|CE16	4.74e-138	14	374	17	353
QRD84022.1|CE16	4.74e-138	14	374	17	353
BAE62044.1|CE16	4.74e-138	14	374	17	353

PDB Hits     

ASPACDRAFT_124849-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	5.96e-83	28	374	27	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999772	CS pos: 22-23. Pr: 0.8172

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_124849-t33_1-p1.