CAZyme Information: ASPACDRAFT_116442-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_116442-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		46373.73	4.7444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878974:1323195-1324663(-)

Full Sequence      

MVRMKALSTFVLPGLASHLSMVAAAGQTCENGVRPYSAWLADSVIARKDALLNADTENDI
ALSLKLGLFQLSVIHLKEYYDAASCAKEDWDAYLKEATDSILPTVLNVTGDIEAPMDIFA
TANGLYYQYEKSGDESYKQGLDALRKAYDGRKRNSEGGFWYYNARPNLSYLDETYPLGAF
TTVYKNRFEPTNATLAENLSKDLNQFKDHCHHDTGLMAHGYDASKSAPWANKTTGASPYV
WDRALGWYHMGLVELLHNADEFPGLLNQTQRDDAYKKYYNLANTIINDVDETTGCWWQVM
EHGGEQGNYIETSGSAIFTYSILKGVRLGYLTGVHPESGKDYKQTAEKCYSWLLENRVVR
DDSGTLSVNGTVGVCTLEDPTYEYYTTQPLSYNSVFGAAPLVMASLEHEMAANAVSS

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_116442-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	73	409	5.2e-61	0.9246987951807228

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.67e-39	114	412	75	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	4.61e-36	41	410	6	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99486.1|GH105	4.32e-151	11	410	12	413
BCS11787.1|GH105	4.32e-151	11	410	12	413
CAK42095.1|GH105	7.55e-145	11	394	12	397
QRD85043.1|GH105	1.51e-124	1	413	4	420
UDD61061.1|GH105	1.22e-123	1	413	4	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.56e-47	33	409	1	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.13e-40	125	409	96	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.01e-39	125	409	86	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	3.67e-39	125	409	96	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.13e-28	215	407	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.13e-28	215	407	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.050065	0.949905	CS pos: 24-25. Pr: 0.8760

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_116442-t33_1-p1.