CAZyme Information: ASPACDRAFT_115341-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_115341-t33_1-p1
• CAZy Family: AA16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		42594.23	5.6482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878973:1821261-1822588(-)

Full Sequence      

MVLSILQKRLPRTILLLIGAIAVILSFSPIHYAQVIARNRSQDESIPLHPISNETLGTQK
IFVVNLPSRPDKRDNIILGSSVSGFRVEWIDGVTPDQVNPKSIPHHWNPDHKPTEYAARR
AHVNAMQQIVQDRLGSAIIMEDDVDWDVTLKTQLQSYALAVRALQGSDGNSTGSPYGDDW
EILWLGHCGMSCKTELPVFLSHQDSTVLPPHHFLPYWRDPPPIDRPDHTRLVCSVGDAVC
SLVYAVSYFGAQKILAALSVSPGQLAEQIDIGAQFDVSLGRMCGHGYLRCFGAYPSLTGG
YQPAGSFSKTSDIHDQDDSVHGAYSFGVMYSTMLNVNRLLSGERTVHATWDDVGVPLDAD
PRNFTVLGGSVAMLEEDGLQKIVDVSAD

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_115341-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	59	270	1.7e-24	0.9723756906077348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	7.69e-21	60	147	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS04381.1|GT25	1.02e-172	7	371	7	370
BCS15969.1|GT25	1.02e-172	7	371	7	370
CAK40570.1|GT25	2.75e-170	7	379	7	378
BCS25421.1|GT25	4.96e-165	7	371	7	380
CAP99059.1|GT25	2.00e-158	1	375	1	382

PDB Hits     

ASPACDRAFT_115341-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8K297|GT251_MOUSE	5.86e-06	52	257	329	507	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.665190	0.334796

TMHMM  Annotations     

Start	End
13	35