CAZyme Information: ASPACDRAFT_112577-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_112577-t33_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	KV878971|CGC4	52160.37	7.8522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878971:2730258-2731789(+)

Full Sequence      

MSSSTYAGSRAANRPSILDPARPMRGLTIAFCLWKVLIFLVIVSCPGLGYDTSTSHFYEY
HDTNNSDVISEDIEDLLLTVPRKFVRWDSIYFLHIAQQGYVFEQEWAFGYGYTQALAYLT
SVLQNLTGLGGGVIIAIEAILLSHVAHYLSVLALYRLSVNVFGNDSTTQRLICLLSSALH
IICPAGAFLSAPYGESLFSFLNITGFYLYSSAYLDNKNGRRLSGDFKTLLSAVLFSAATT
VRSNGILSGILFAHDAFLQLRRVVSQSLSLNACAHLLVAIVSGCIIALGLILPQYIAYTA
YCGDDPNSRPWCQWYVPSIYGWVQTHYWNVGFLRYWSISNLPLFVLAMPMLAILCRSSFW
ALDMAVPFIYPRALSGVDHASSSATTASLLLRLAAPQGILALLALTSYHVQIINRIASGY
PLWYWYLAYLVSGNWGQIPPSIQHSRTFTGAVQGMVAYALVQATLFGSFLPPA

Enzyme Prediction     

No EC number prediction in ASPACDRAFT_112577-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	30	473	1.1e-116	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.28e-41	25	473	2	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	4.15e-23	86	473	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01167.1|GT76	9.63e-251	4	473	2	469
BCS12914.1|GT76	9.63e-251	4	473	2	469
CAK38795.1|GT76	1.57e-246	4	473	2	466
QMW40534.1|GT76	2.17e-188	7	473	2	452
QRD82967.1|GT76	8.79e-188	7	473	2	452

PDB Hits     

ASPACDRAFT_112577-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	1.30e-180	7	473	2	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.62e-152	4	473	8	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.15e-83	23	473	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.47e-77	16	473	2	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.03e-44	83	473	45	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999954	0.000064

TMHMM  Annotations     

Start	End
31	50
129	151
171	193
197	214
276	298
332	354
416	438
448	470