CAZyme Information: ASPACDRAFT_110316-t33_1-p1

Basic Information

• Species: Aspergillus aculeatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus aculeatus
• CAZyme ID: ASPACDRAFT_110316-t33_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	KV878970|CGC19	94638.29	6.2356

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AaculeatusATCC16872	11165	690307	322	10843

• Gene Location: location=KV878970:2835034-2837850(-)

Full Sequence      

MSSADWQKKVGQLFVVGFHGLEPSAEIKTLIHEYGVGGIVLFKRNIIDIAQLRALTDALQ
REAQVAGHTHPLFIGIDQENGWVTRISPPMASQLPGPMALGATNSTDLAYKVGMATGQLL
KHVGINMNYGPVCDINSEPLNPVIGVRSPGDDPEFVGRFASAIARGQRQHSVISCVKHFP
GHGDTATDSHYGLPVISKTREQLEKCELVPFRRAAAEGIEAVMTAHISLPGLGDSKLPAT
LSPDVLSILREDMEYDGMITTDCLEMDGIRATYGTEEGAVLALAAGSDSIMICHTYDVQV
ASIRRVCEAVEAGRVSMTRVEEAYRRVTQLKQKSLRWEEALNTDNAFESRFREIDLQNRE
LADAAYAKSVTIVRDTSKTLPVSRSSKVVLLFPGDETPAGGAVDGEGLGRKGSYKGSVYL
DALRNHNPTVTEIRYGAAGLSAEEWRNVETADAVILTTINARESPFQRKMGQELLSRARA
LVSIAACNPYDFLDDPTIGTYITTYEPTLEAFTAAAATIFGAATATGKLPVGTQKPRLSI
ELSPLDNSEDLKQVHTVWNTSLPTYPLPLENLQKLLPQPHGRHFLARTGNTIVGFCLTYS
RTTDDDDDKKSAYLSAIAVLPATQSQGIGSTLIQEVIAWYTTTQQITRLDLSSSFPRFWP
GLPDDLAPSATRFFENRAFIFTTPPPRHVDLYRSITDFQLEERHTRKATSQGYTFAPLQP
DQYEECIAGQRKNFSHNQAWVQTYITLHPQTHPDSIMTVFSPQGHQIGWTLMLDPSSPFL
QIQWAMPPVCGGADSRTGLIGCVGVDQEHRGKGVGVAMLAHALAHLRSRGVQGVMVDWVV
LEGFYESVGFDVWRGYRLGSVRI

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	291	4.1e-60	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.58e-86	9	416	6	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.83e-81	9	330	5	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.88e-48	36	294	26	281	beta-hexosaminidase; Provisional
185053	PRK15098	5.88e-13	9	393	50	418	beta-glucosidase BglX.
173926	NAT_SF	2.33e-07	792	837	20	65	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93582.1|GH3	0.0	7	863	7	859
BCS06215.1|GH3	0.0	7	863	7	859
CAK37722.1|GH3	0.0	1	863	1	859
BCR85716.1|GH3	0.0	1	861	1	854
CAP94355.1|GH3	0.0	1	861	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	4.94e-146	8	859	11	856	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	7.00e-96	7	530	14	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.00e-62	8	531	46	615	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.49e-61	8	531	20	589	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.69e-61	8	531	50	619	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.57e-61	8	531	46	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	6.76e-52	26	333	54	382	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q0A911|NAGZ_ALKEH	6.71e-38	15	341	7	332	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
sp|A9M1Z4|NAGZ_NEIM0	1.65e-37	24	297	21	293	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1
sp|Q7NWB7|NAGZ_CHRVO	6.94e-37	24	294	19	286	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPACDRAFT_110316-t33_1-p1.