CAZyme Information: APA16197.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA16197.1
• CAZy Family: GT62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		34944.95	9.3061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017829:844670-845721(-)

Full Sequence      

MHLAYPSRKASNPPAYLAPRSSRFPMLRRSRVKTILLAACAIGAVFFILSSILGGADRIP
SGTPPVVIVTVLDTVGYSKEYQDSVKENRIQYARKHGYATFFPSIGDYDVQGSPNSWSKV
PAARHALSQFPHSEYIWVLEQNALIMNPALKVEDHIMEPKRLESLMIKDQSIVPPDSVIK
TFPNLKGGNVDLVLTQDKDGLSQASFIIRKGEWSKFFLDTWFDPLYRSYNFQKADTHALE
HIVQWHPTILSKLALVPQKIMNAYNSDDADGYKDGDFVVRFPGCDQSGRDCGKEAEKYTR
QWRTVFAQR

Enzyme Prediction     

No EC number prediction in APA16197.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	64	292	1.6e-76	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.07e-85	62	291	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	5.46e-06	88	221	156	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA16197.1|GT34	3.42e-229	1	309	1	309
ATZ57222.1|GT34	7.32e-215	1	309	1	309
QSZ33097.1|GT34	2.12e-200	1	309	1	308
VCU39709.1|GT34	3.45e-130	1	306	1	309
VBB77835.1|GT34	1.15e-126	1	308	1	312

PDB Hits     

APA16197.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	8.31e-39	78	301	85	309	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	6.31e-37	81	298	123	346	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	6.65e-35	81	298	123	346	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	3.23e-31	87	284	113	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|P46985|MNN11_YEAST	6.78e-29	58	294	152	411	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999814	0.000193

TMHMM  Annotations     

Start	End
34	56