CAZyme Information: APA15786.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA15786.1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		45579.53	4.3207

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017828:1180423-1181767(-)

Full Sequence      

MYISTTLLTAFLASTVSAWLPGDKELFSKEGVSLFDPQAKNSTTRRWTPASGKIRGVNLG
SLFVFEPWIAEDAWSAMGCGGYASEFDCVSGLGQEQANSAFQNHWKTWITADDIAQMASF
GINTVRIPVGYWMMESLVYSDSEHFPQGGLQYLESICDAAANAGFYIIIDMHGAPGAQVA
YNADTGQNAPTPGFYVDYQYARGEKFVAWLATNIHQNNALRNVGMIGIVNEPVQNAGQVA
GMISSYYPAAYKAIRDAENALGVTSNNYLHVQAMDQGWGSGDPNSGFGDGVFLAYDEHRY
LKWSDISVSQDAYLQSSCTYNPISSTGGPTIVGEFSISPPDDVQDTGGWSTSTQGAFYKK
WFEAQVMGYENHALGWIFWTWKSQLNDYRWSYQDAVQAGIIPKDLDSVAGSGACNGY

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	93	393	5.1e-144	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.72e-27	53	417	17	397	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.99e-13	108	381	24	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA15786.1|GH5_15	0.0	1	417	1	417
ATZ51037.1|GH5_15	1.45e-264	1	417	1	417
CCD56844.1|GH5_15	1.45e-264	1	417	1	417
QSZ32098.1|GH5_15	3.62e-258	1	416	1	416
QGA15346.1|GH5_15	3.23e-187	3	414	1	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.56e-30	47	405	2	382	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.69e-30	47	405	7	387	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
3N9K_A	3.19e-30	47	405	7	387	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
2PF0_A	4.45e-30	47	405	8	388	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	5.60e-30	47	405	2	382	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DGM6|EXGB_NEOFI	1.30e-179	12	414	11	399	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q5B6Q3|EXGB_EMENI	1.12e-175	18	414	16	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|B0XRX9|EXGB_ASPFC	3.61e-171	12	393	11	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	4.17e-170	12	393	11	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	5.31e-163	2	415	4	404	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000606	0.999379	CS pos: 18-19. Pr: 0.9685

TMHMM  Annotations     

There is no transmembrane helices in APA15786.1.