CAZyme Information: APA15758.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA15758.1
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792		90376.16	4.6831

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017828:1077134-1079658(-)

Full Sequence      

MHPVKCQWLLLLLIFAITFNVIVQAEAAQSTQGLVELLKRRLPAHVNDFEFKIRGNHTLG
ATNDDYSVSQTCTGVILVEGNSLSALATGLRKYFTDILHVDIWWYIGLQLHLAPKEFPPL
NSTLRGSSIVPWRYHFNTVTFSYTTAFWTWDDWELQLDWMSLHGINLSLAWVGYEKTLLS
TLLTLGLTTTEILSFFSGPAFQAWNRFGNIQGSWGGTLPLSWIEEQHLLQKKIVKRMVEL
GITPVLPAFTGFVPSALRRIAPNANIINGGDWGNIFPVEYSNDTFLYPTDPLFTTLQHKF
LSFQSEYYGNVTHIYTLDQYNENNPASGDLSYLRNVSRGTYESLQSFDPCAVWMLQGWLF
YSLSSFWTQDRIEAYIGGVPKNESMLILDLFSESFPQWERTHYYYGKPWIWCQLRDYGGT
LGLYGQIYNITNSLIEAFRESENMVGVGNTMEGQGGNGLMYELLLDQAWNIDPIDTEDYF
KSWVRKRYHIKGAKKRLPGEIYEAWDILRRTAYNNTNLTLADSVPKSLHELQPNITENHG
RLGQSSTIDLYDPDDLFRAWELLYNASVSVPELWEDKGWKFDMVDITRQVLAERFKLEYV
ELIEKYKKGADISCDGDILIGILESLDDVLSASPHFRLDTWVNAAVSSAPLPASTNCSST
SINNSSLLFNSSTSILTSNLTPTQQFFAYNAINQITIWGPTGQIDDYASKSWGGLVRGYY
LPRWKMFLEYIDEVRFEEFNTTEVKARLDSFELGWQFGGGTGYVEGGDGRGNLKELVGEL
FEELELWGVREV

Enzyme Prediction     

No EC number prediction in APA15758.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	74	650	1.5e-169	0.8386123680241327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	2.90e-177	133	470	1	332	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	4.26e-72	479	757	1	240	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	2.19e-20	32	118	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA15758.1|GH89	0.0	1	792	1	792
ATZ50503.1|GH89	0.0	1	784	1	778
QSZ32336.1|GH89	0.0	1	780	1	767
QKX62920.1|GH89	1.56e-278	27	756	17	722
QGA19502.1|GH89	2.52e-274	30	756	33	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	5.03e-120	24	729	2	657	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.30e-76	63	728	201	821	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.46e-76	63	728	209	829	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.22e-75	63	728	224	844	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	2.26e-120	24	729	25	680	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	5.49e-115	1	727	1	747	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999807	CS pos: 25-26. Pr: 0.9811

TMHMM  Annotations     

Start	End
7	29