CAZyme Information: APA14473.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA14473.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751	CP017826|CGC2	82324.14	9.5846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017826:163085-165474(+)

Full Sequence      

MPYTPPSQRSPASSTTHSPAVSRRSSYQLSHHAPAPRPELPRSTSYLTRHRRTPSVKSTP
FGPTLDPTPPGTADSEKGPSHDTNSSLTASSSLRQSPPPVTDDNKMPIGVVMSPPDSTQN
SDEEDNGSRGRKLENLEELQAAIRVIEQHRESSPNRASSEIERLTQAISLLPINKDTKET
KDKPTSEHIEKTQPPRKLQHQRSSTETVFLDLRSNQNNQSAPETPTTGSDDELSDEEAEM
ARRKPQMLRKKSGELVRPALRPSSAKRRPSSMPGTPTFSKAVHFDSHLEHVRHFLQVDRP
LAVSAGSSPVESYESDSEFPFGHDDDSNNRGPPFEWEIIISNFPPMTAYRAAMPIRVERV
FLSADNKNLIGTVAVTNLAFNKLVVARFTLDYWKTTSEVVAEYNNDIRQPKHSDGCDRFN
FNIKLADQANLEAKTMFFCVKYCVNGVEYWDNNNSTNFQIDFRKKAKLQNGKKSSPAASR
SANSLPRSNKRSPPAAPIKKSTAFDDFSNDFDSKYLNSNFKLPVADYLGDSNTVRLKGVK
SAVTLASDNRSRRATINTNTAGGQAFGHRYDFGASLNAAISAANSSLGEKSGITMKSKRP
APISETRKFINHDEQVSPLSMSAPKTFDHSTPSKTLPSAGTSTSGTDSPRPVGTEKPVLA
SQSYNELLDKYCFFGSVKNSPQLKDGTARSGQYDGNNDDGYLFGSVDSTASNSPITMPHM
NHRSSSHGASPEGTRSTSPAPMTGFVSAIRG

Enzyme Prediction     

No EC number prediction in APA14473.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	354	460	1.7e-31	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	1.36e-48	349	461	1	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	3.22e-09	377	460	1	75	Starch/carbohydrate-binding module (family 53).
411474	fibronec_FbpA	1.29e-04	2	172	184	352	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA14473.1|CBM21	0.0	1	751	1	751
ATZ52170.1|CBM21	0.0	1	747	1	749
QSZ31495.1|CBM21	0.0	1	747	1	750
CCD55271.1|CBM21	0.0	1	673	1	673
VDB93413.1|CBM21	1.11e-200	1	749	1	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2M83_A	3.32e-12	371	465	48	138	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]
2EEF_A	4.99e-10	366	460	45	135	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99MR9|PPR3A_MOUSE	2.84e-10	371	467	145	237	Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
sp|Q7TMB3|PPR3C_MOUSE	5.34e-10	339	460	134	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q5U2R5|PPR3C_RAT	5.34e-10	339	460	134	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q00756|PPR3A_RABIT	1.12e-09	371	465	146	236	Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
sp|Q6IN01|PPR3B_RAT	4.06e-09	335	460	105	231	Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in APA14473.1.