CAZyme Information: APA14200.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA14200.1
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		48536.09	4.1912

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017825:1055229-1056701(-)

Full Sequence      

MKTTTLSLAGLSLLQLTLAQPFNRHNAHRAIHNKRDLVTVVDTVVVAATEVQEVIIYVDS
EGNPLSTTTKYLDNEPTTTYESSSVVPTSSSSATTTTPIVDVAVQPSTQIDVAAASTTPE
APSVQVSVAVSLSVAVPVPSTGPASPVVVTSTSVVSPVAATSTSVAAPVVSSSSSAVVAP
VASSSSTTSSAAVASTSAVVASSGGFGFAYSPYMANSACKTQDQVNQDFAAIPSSYSTVR
IYGTDCNQVTTTLVAAKKFGFKIFAGVYDFTEVATETQAIVDAVGGDWSVITTISIGNEW
VNNGVTDAAGVASAVATARGILSAAGYTGKIVAVDTLAATKLYPSLCDNVDYCAVNCHPF
FDTNTAAEAAATFLSTQISELRALLSNPDMEIVISETGWPSAGTSHDQAVASPEAQTTAI
AAIKGLFASNSSNVYLFSTFNDYWKVNTPALYMAEQAWGYLGNAPSDVSAGLI

Enzyme Prediction     

No EC number prediction in APA14200.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	214	459	1.1e-22	0.9292604501607717

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.06e-52	204	465	44	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	8.48e-06	385	459	222	295	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA14200.1|GH17	2.89e-260	1	473	1	473
ATZ47406.1|GH17	6.93e-196	1	473	1	468
ATZ47405.1|GH17	6.93e-196	1	473	1	468
QSZ31209.1|GH17	9.38e-140	1	473	1	339
QPC72999.1|GH17	1.39e-69	207	462	111	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.29e-11	219	442	49	269	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.91e-10	219	442	49	269	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.44e-50	200	463	121	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	1.93e-49	202	463	133	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	4.90e-49	202	463	130	385	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	4.79e-35	209	465	285	542	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q4WC60|BTGE_ASPFU	3.90e-34	201	459	304	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999706	CS pos: 19-20. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in APA14200.1.