CAZyme Information: APA13299.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA13299.1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	CP017823|CGC2	33673.04	4.0659

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017823:2050610-2051697(-)

Full Sequence      

MQLPMTTLIALLPFFLQANAQASGSGTTTRYWDCCKPSCSWSDKAVLASGSGPVGTCDIN
DSPLSDPTAMAVSGCNGGTSYMCSDQSPWAVTDDLAYGYAAVNIAGGSESSWCCACYELT
FTSTALAGKKMIVQATNTGGDLGSNQFDLAMPGGGVGIFNGCTTEFGAPSSGWGSQYGGV
SSATDCSTFPAALQAGCNFRFGWFEGADNPTVDFKQVECPAALTKSTGCKRADDSSMPAP
DVAGSASASPIAKVATSSSSSSSVAPVAATPASSSSSSSTPAVVKPTSVKPSSSVAAAPA
PVTTHVSSSSSSKTVAPQSTAASAPYSGEDDDTCDAE

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	26	230	1.1e-87	0.9949494949494949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	5.18e-79	25	230	1	214	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA13299.1|GH45	5.15e-197	1	337	1	337
CCD33730.1|GH45	1.79e-157	1	244	1	244
ATZ56133.1|GH45	1.79e-157	1	244	1	244
QSZ34435.1|GH45	4.84e-148	1	241	1	240
QDS72490.1|CBM1|GH45	1.80e-114	14	257	17	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GLY_A	1.72e-100	22	238	1	209	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	1.98e-100	22	238	4	212	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
6MVI_A	6.40e-100	6	238	9	230	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5H4U_A	2.24e-90	5	231	1	221	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
1HD5_A	2.28e-88	26	239	3	209	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	5.00e-95	18	239	14	229	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|D3GDK4|GUN_CRYAT	9.43e-90	5	231	1	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P43316|GUN5_HUMIN	9.50e-87	26	239	3	209	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|O97401|GUN_PHACE	7.37e-61	13	229	27	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	2.18e-48	25	231	268	500	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000185	0.999795	CS pos: 20-21. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in APA13299.1.