CAZyme Information: APA13257.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA13257.1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	CP017823|CGC3	67027.04	4.8540

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017823:1919326-1921331(+)

Full Sequence      

MRFYSVTAVLSLLCTQAIATSPSDSAASYNNLNSFIASERKIALQGVLNNIGPDGSKVSG
AGNYVVASPSKANPDYFYTWTRDSALTLKMIVDEFIFGNRALQPQIEKYVKAQAILQTVT
NPSGSLLYDGLGLGEPKYKVDGTQFNGAWGRPQRDGPALRAIALMAYSNWLINHDQFQRA
KLVIWPIISNDLSYIGEYWNSTGFDLWEEELGSSFFTLQNQHRAFIEGQTLANKLGVECT
GCLNAPEVLCFLSQSFWNGEYIISNVNVDNGRTGLDANSILGSISIFDVDGSCDSPNLQP
CSSRALSNFRAVVNSFRGIYGINAGIKNNSGIAVGRYAEDIYQGGNPWYLITTAAAEFLY
DAVAQWKNQKALTVDSISINFFRDLYPTIKLKSYTNKDNEFTKILNAITTYADSFVTVAQ
KYTPVDGSLAEQFDRNTGTPISANDLTWSYAAFVTMAQRRSGQYPASWGSSASSIPPPNC
APSSTQGVYIPAIAAGAPNITATCKYAVQFYVNATTYYGENIYVIGNTTDLGNWDLNSAL
PMNAGMYTTEYPLWYVDTKLTAGDTVSYVFVRQQDCGQAPIYESGNRTVTVPECGTGGTK
VVRAAWAGSVGSSGSC

Enzyme Prediction     

EC	3.2.1.3:94	3.2.1.3:71

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	65	457	5.9e-70	0.9335180055401662
CBM20	507	596	1.1e-22	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	6.36e-121	42	458	2	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
99886	CBM20_glucoamylase	6.70e-39	506	606	7	106	Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Glucoamylases are inverting, exo-acting starch hydrolases that hydrolyze starch and related polysaccharides by releasing the nonreducing end glucose. They are mainly active on alpha-1,4-glycosidic bonds but also have some activity towards 1,6-glycosidic bonds occurring in natural oligosaccharides. The ability of glucoamylases to cleave 1-6-glycosidic binds is called "debranching activity" and is of importance in industrial applications, where complete degradation of starch to glucose is needed. Most glucoamylases are multidomain proteins containing an N-terminal catalytic domain, a C-terminal CBM20 domain, and a highly O-glycosylated linker region that connects the two. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
395557	CBM_20	1.17e-23	507	601	2	95	Starch binding domain.
119437	CBM20	1.25e-19	508	606	2	96	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
99882	CBM20_CGTase	3.08e-18	507	601	4	99	CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. CGTase, also known as cyclodextrin glycosyltransferase and cyclodextrin glucanotransferase, catalyzes the formation of various cyclodextrins (alpha-1,4-glucans) from starch. CGTase has, in addition to its C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13 and an IPT domain of unknown function. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA13257.1|CBM20|GH15	0.0	1	616	1	616
CCD52574.1|CBM20|GH15	0.0	1	616	1	615
ATZ55778.1|CBM20|GH15	0.0	1	616	1	615
QSZ34432.1|CBM20|GH15	1.48e-290	1	616	1	617
CAA47945.1|CBM20|GH15|3.2.1.3	7.35e-286	5	616	7	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FHW_A	2.54e-287	5	616	7	616	Chain A, Glucoamylase P [Amorphotheca resinae],6FHW_B Chain B, Glucoamylase P [Amorphotheca resinae]
6FHV_A	4.71e-193	31	592	7	579	Crystal structure of Penicillium oxalicum Glucoamylase [Penicillium oxalicum 114-2]
2VN4_A	6.69e-189	31	592	1	583	Chain A, GLUCOAMYLASE [Trichoderma reesei],2VN7_A Chain A, GLUCOAMYLASE [Trichoderma reesei]
6FRV_A	6.44e-183	32	606	3	615	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
3EQA_A	1.30e-163	32	489	3	458	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q03045|AMYG_AMORE	1.31e-286	5	616	7	616	Glucoamylase P OS=Amorphotheca resinae OX=5101 GN=GAMP PE=1 SV=1
sp|P69327|AMYG_ASPAW	6.40e-183	1	606	1	639	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1
sp|P69328|AMYG_ASPNG	6.40e-183	1	606	1	639	Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
sp|P22832|AMYG_ASPUS	1.29e-179	1	606	1	638	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P0DN29|AMYG_ARTBC	1.61e-178	44	606	39	609	Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02327-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999736	CS pos: 19-20. Pr: 0.9825

TMHMM  Annotations     

There is no transmembrane helices in APA13257.1.