CAZyme Information: APA12832.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA12832.1
• CAZy Family: GH65
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
938	CP017823|CGC9	105399.64	5.9480

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017823:436284-439656(+)

Full Sequence      

MSEEFNFQSPSGDLAATPQDGRPTMVERHQSVPVPPRSRPESLIPPSRPHSIMSTGSAGS
RDRHTLVAKYLQRRCAAAKWLQPIEEEDGTINESSWVGVAMRLPDGSYYTEPPNVDNKFY
TVMQYLNCKVAFTMSSDITAALMDQIGPFQTEIQVHPRGIRLPIVQNLSELAIGGGGVSK
KSYLCVLREERLVLIWNESVESIMTHGVDVESILVGMIWGSQIGTMTATSPFASMTPLIG
QTPGQTPGRTPSAISEDPEFNEKMGIVQAAIEREENKDTLFNPDIEAAAPPERPFLLLHA
GVIGFAMTLVVFVEMLCASRLITEYQWDGGVLRFALVAVIPFFVCFSLFFMVVIAGSLFQ
LFGPLTYVRKNSRFYSAKPPKRGRYPDLELPHITIQMPVYKEGLKGVIIPTVTSILAAIR
YYEAQGGSASIYVNEDGMQAVDPELREARRTFYELNNIGYCSRPKHTHSKKKWYQGKKVQ
DNPEGFERKGQFKKASNMNYCLSFSIRVEDELLRLIAAKSTAENRPEGDITPDEEDLLYK
QALETCLEQDEGRTMAGGNVRIGDIILIIDSDTRVPEDCLLLGALEMHESPEVAILQHAS
GVMQVAHNPFENGITYFTNLIYMSITFAVGNGDCAPFVGHNAFLRWKAVQSVAYEEDGQL
KFWSDDHVSEDFDMSLRLQMAKFIVRLATYHEGGFKEGVSLTVYDELARWEKYAYGCNEL
VFNPIYKWWRGPFTKLFMRFLWSDIKLTSKITILAYIGTYYAIACAIPLTLANYIMVGWF
NDSLDQFYLTSWKIFVGMAVIFNVLSPLAFAMLRHRLGEKVFVSSIVETAKWTPMFILFF
GGISFHLLTAILCHFFSIKMEWTATAKEVEAGGFRIGLDKIFRDFKWMYLAIVPILAGMV
YLGAFAPRGYEVTDFTAIVPLSNQVACHILLPFALGLF

Enzyme Prediction     

No EC number prediction in APA12832.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	565	773	9.2e-55	0.9746192893401016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	5.55e-54	565	777	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.99e-09	563	871	138	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.29e-09	563	671	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	1.86e-04	564	709	97	243	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
132997	Glyco_tranf_GTA_type	0.008	563	603	78	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA12832.1|GT0	0.0	1	938	1	938
ATZ55570.1|GT0	0.0	1	938	1	938
QSZ28760.1|GT0	0.0	1	913	1	913
CCD53801.1|GT0	0.0	1	617	1	617
QIW95398.1|GT0	0.0	54	938	35	921

PDB Hits     

APA12832.1 has no PDB hit.

Swiss-Prot Hits     

APA12832.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
300	322
334	356
753	775
788	810
836	858
887	905
915	937