CAZyme Information: APA12715.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA12715.1
• CAZy Family: GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	CP017823|CGC10	76428.35	4.9933

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017823:14938-17017(-)

Full Sequence      

MLYAQGNRLVYRYDAEELWIDPWGPNAFRVRSTKESRYPDPDELWALQEIETPAPVINVQ
EKEASIINGSIRATITSRGKVVIYDGEGKVLLEEYARHRLDVTDPKCSAINVEAREFKPN
PGGNSTHHLTVRFESQDKNEKIFGMGQYQQPYLDLKGLDLELAHRNSQASVPFALSSRGY
GFLWNNPAIGRAVFGKNIMSFEAYSTSFLDYWVVAGGSPSEIVHRYAAVTGTVPMMPEYG
LGFWQCKLRYQTQEELLEVAREYKKRELPIDLIVIDFFHWPTQGDWRFDEKFWPDPDAMI
KELKELNIELMVSIWPTVDTRSENFEEMLERGYLVRTDRGIRIVMDFEGDTIHFDATNPG
ARKYIWEKAKKNYYDKGIKVFWLDEAEPEYTAYDFDNYRYHRGTNLSIGNTYPVEYARAF
YEGMSAAGQKNVVNLLRCAWAGSQKYGALVWSGDIASSWSSFRNQLTAGLNMGIAGIPWW
TTDIGGFHGGDPSDPAFRELFVRWFQWGTFCPVMRLHGDREPKQPQVGEGGGSTCLSGAP
NEVWSYGKEVYEICKKYMKLREEMRDYTREMMAEASEKGSPVMRPLFYEFPDDPRCWEIE
EQYMFGPKYLVCPVFEAGAKHMKVYLPAGQSWKIIGNGNEESWNGGQDIEVACSIETMPV
FIKNN

Enzyme Prediction     

EC	3.2.1.177:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	211	664	7.7e-146	0.9882903981264637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269877	GH31_xylosidase_XylS	0.0	231	561	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
224418	YicI	2.44e-169	57	665	65	667	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	5.40e-148	213	663	2	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269879	GH31_xylosidase_YicI	5.30e-71	231	561	1	305	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
269878	GH31_NET37	6.68e-68	235	632	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA12715.1|GH31	0.0	1	665	1	665
ATZ49071.1|GH31	0.0	1	663	1	663
QSZ32489.1|GH31	0.0	1	665	1	665
KAE9376285.1|GH31	0.0	1	663	1	658
KAF2643698.1|GH31	0.0	1	661	1	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	6.01e-111	16	661	17	704	Xylosidase from Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
7KMP_A	3.98e-94	60	663	121	860	Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	2.51e-83	199	663	393	869	crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
5JOU_A	9.82e-82	200	663	366	839	Bacteroides ovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
6JR6_A	2.20e-70	170	663	195	683	Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01336|YCR2_PSEVU	1.54e-217	2	523	4	528	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
sp|Q9P999|XYLS_SACS2	1.01e-120	125	664	98	618	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
sp|A2QTU5|XYLA_ASPNC	4.86e-110	16	661	35	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
sp|A7LXT0|GH31A_BACO1	4.98e-81	200	663	365	838	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	7.00e-63	11	663	52	669	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in APA12715.1.