CAZyme Information: APA11453.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA11453.1
• CAZy Family: GH35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	CP017821|CGC1	50254.23	4.3505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017821:51898-53572(-)

Full Sequence      

MLSTFALTATTAVLFGSLAVNAEIQLDINDDTSIKNAAATIAYDMMTYYKGNQSGGIPGV
LPGPPPNPTWGYYWWESGAMWGSLIDYWYYTGDSSYNDDAMAGIQWQTGANNDMMPANWS
QSMGNDDQGFWGMTAMSAAESKFPDPPAGRPGWLALAQAVFNTQAVRIDNATCGGGLRWQ
VYPYLTGYDYKNSIANGCFFNIGARLARYTNNETYARYAEETWNWVTNVGYMDKEYNIYD
GAHIEKNCTDINKVQFSYNSGVYLLGAATMYNYTNGSDIWRERVDGLLNATFRNFFPTGD
IAYEIACEAKLSCTTDMFSFKAYLTRWLAATTKMVPYTYEKIMPYLKASAIAAAQQCSGP
SPFNGRTCGLSWSKGTDWDGTSGVGQQMAAMSVIFANLVQQTLAPVTNSTGGTSVGNPAA
GSGSTSSLDPVSPPNTGDRVGAGIVTTVVLLGMTGMFAWMSF

Enzyme Prediction     

EC	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	407	5.3e-108	0.9581005586592178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	33	391	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	2.12e-05	153	264	97	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA11453.1|GH76	0.0	1	462	1	462
ATZ53131.1|GH76	3.74e-315	1	461	1	461
QSZ36850.1|GH76	1.65e-302	1	462	1	462
CCD34628.1|GH76	2.06e-292	45	461	1	417
VCU41163.1|GH76	2.32e-243	22	461	19	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.47e-143	16	439	18	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	5.26e-132	24	462	19	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.16e-131	13	462	12	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	4.60e-118	6	460	3	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q05031|DFG5_YEAST	1.15e-117	24	462	27	458	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	2.77e-117	24	421	20	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000859	0.999105	CS pos: 22-23. Pr: 0.8544

TMHMM  Annotations     

There is no transmembrane helices in APA11453.1.