CAZyme Information: APA11333.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA11333.1
• CAZy Family: GH35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		47383.77	4.7248

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017820:2045517-2046901(+)

Full Sequence      

MVSSKLLVAFAAVSVVPIQCINLNVTSVDSIKSAASTIARDLVGLYNQSQTAGNPIGVLN
APYYWWESGAMFDTLIQYWRLTGDSQYNRIVTQGLVYQQGIGSSFMPENQTKFLANDDQS
TWALAAMSAAEARLGEVQNVTWLNLAENVFNEQVARWDEKTCNGGLRWQIFTFNAGYTYK
NSISNGNFFQLSARLAAYTGNTTYSDWATKVWNWTKGTGLIDENFNVFDGADVTKNCSMI
DKPQFSETAGTFIAGAAYMYNHTNGDSQWKKSLDGLLNRTISVFFPSGIATETACESKNA
CNIDQRAYKGILGKWLVDTIQVAPYTNSIINTQLIGTAQAAARTCGDNGCAFDWSGNGKN
VSTGVGEQIDALSYVQGLLHSQAAAPATQNSSNSTTSSSGSSTSTSASAIASASNNAATG
MVLEQSAISFSVMGAVAWLVL

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	390	1.7e-93	0.9720670391061452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.79e-149	30	372	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.32e-05	63	385	44	350	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA11333.1|GH76	5.00e-307	1	441	1	441
CCD55529.1|GH76	8.50e-232	1	441	1	441
ATZ52997.1|GH76	3.45e-231	1	441	1	441
APA11655.1|GH76	1.89e-125	18	391	21	398
ATZ53339.1|GH76	3.17e-121	18	391	21	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.50e-85	29	391	34	415	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	3.79e-97	19	376	18	381	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.29e-88	25	388	24	388	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q05031|DFG5_YEAST	1.39e-85	22	391	28	404	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	2.27e-85	6	388	2	396	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	7.24e-84	30	391	28	400	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999776	CS pos: 20-21. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in APA11333.1.