CAZyme Information: APA11225.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA11225.1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504		58221.47	6.5042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017820:1700679-1702420(-)

Full Sequence      

MGFVQRVMKRMPSSTQLPLDDGKEKSKVTSRLAFFRRPLRLKGNSSISIPLGVVLLFPCI
VVVLILVLFVRHPKSGVGILMPAGAPPAIRRISEQHDKVFVTGCAEPDTSQPRANAAFVV
LARNKELEGVIQSVKSIERHFNRWYHYPYVFLNDQEFNSTFKEVIQNYTSAPCEFGTIDP
KHWGFPDWIDPKVAKEGIAKQGDAAIMYGGMESYHSMCRFYSGFFYKHELLAKYEWYWRL
EPEIKYFCDITYDPFLKMIDANKTYGFTIAVKELKETVPNIFRYASAYKRVNNITSQGLW
EMFIEPPPEEPKEVPEDDPAYKRPLPEEILRGDPSRASLPEIDPEAMEGEKYNMCHFWSN
FEIARLSWFRSKEYEDFFQMMDRSGGFWMERWGDAPIHSLAAGALLAPRDIHYFRDFGYR
HTTIQHCPANAPARQRAREPFLEKTTLDEKKRKEEDEYWDSWDPVKENGVGCRCRCDTDI
VDVEGKQGSCLAEWVDVAGGWASP

Enzyme Prediction     

No EC number prediction in APA11225.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	113	422	1e-127	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	4.21e-145	110	500	77	392	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	2.13e-110	107	421	36	311	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA11225.1|GT15	0.0	1	504	1	504
CCD42482.1|GT15	0.0	1	504	1	504
ATZ52912.1|GT15	0.0	1	504	1	504
QSZ36986.1|GT15	0.0	1	504	1	504
VDB94551.1|GT15	0.0	1	504	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	2.74e-79	113	428	26	301	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	2.00e-72	113	444	66	372	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	2.59e-62	113	428	102	388	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94565|OMH4_SCHPO	2.46e-134	61	499	36	434	O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh4 PE=3 SV=2
sp|Q96WW1|OMH5_SCHPO	5.64e-117	89	501	56	418	O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh5 PE=3 SV=2
sp|P53966|KTR5_YEAST	1.28e-109	59	497	23	489	Probable mannosyltransferase KTR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR5 PE=1 SV=1
sp|P40504|KTR7_YEAST	1.94e-107	82	491	51	475	Probable mannosyltransferase KTR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR7 PE=1 SV=1
sp|P46592|MNT2_CANAL	2.34e-78	113	430	139	417	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999656	0.000354

TMHMM  Annotations     

Start	End
47	69