CAZyme Information: APA11104.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA11104.1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553		61055.82	6.8446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017820:1266648-1268360(-)

Full Sequence      

MTTDLLSSSQVNDFDYVIVGGGTAGCVIASRLSEYLPNKKILMIEGGPSDFNNDKVLKLK
EWLTLLGGELDYDYGTTEQPNGNSYIRHSRAKVLGGCSSHNTLISFRPFEYDCQIWESLG
CKGWGFKTMMRLIDNLRNQTNPVHPRHRNQICKDWVQSCSTAMDIPIIHDFNHEIREKGA
LEQGVGFFSVSYNPDDGRRSSASVAYIHPILRGAESRPNLTILTNAWVSKLNFDSNKTVK
SVNVTLKSGEKLTVSPKTETILCAGAVDTCRLMLLSGVGPAQQLKDLGIPVIHDLPGVGE
NLIDHPESIIMWELNAPVPPQTTMDSDAGIFLRRELPNAAKNHTHPELNPKGLPDGTIAD
IMMHCYQIPFCLNTARLGYDAPLNAFCMTPNIPRPRSRGRIYLTSSDPSIKPALDFRYFT
DPEGYDAATIVAGLKAAREIAKKPPFSNWLLREVAPGPEIQSDEQLSEYGRKVAHTVYHP
AGTTKMGSEEDKMSVCDEKLKVRGLKGVRVADAGVFPTMTTINPMLTVLAIGERAAEMIA
QEAGWRGMVEPRL

Enzyme Prediction     

No EC number prediction in APA11104.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	541	1.4e-141	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.73e-115	12	544	6	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.35e-100	12	539	4	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.88e-47	395	535	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.57e-29	1	542	43	579	Protein HOTHEAD
366272	GMC_oxred_N	8.49e-19	14	307	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA11104.1|AA3_2	0.0	1	553	1	553
ATZ52763.1|AA3_2	0.0	1	553	1	553
QSZ37245.1|AA3_2	0.0	1	553	1	570
VDB94924.1|AA3_2	0.0	1	553	1	552
CAE7217204.1|AA3_2	0.0	14	553	15	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	3.27e-128	1	539	1	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	4.62e-128	1	539	1	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.30e-127	1	539	1	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6ZH7_A	3.71e-60	7	543	1	564	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	7.17e-60	14	543	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.68e-127	1	539	1	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.07e-79	14	542	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	4.63e-73	14	539	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q4L9D7|BETA_STAHJ	2.42e-70	9	539	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q8CMY2|BETA_STAES	7.45e-69	12	539	6	538	Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000006

TMHMM  Annotations     

There is no transmembrane helices in APA11104.1.