CAZyme Information: APA11005.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA11005.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		51458.87	6.4320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017820:850747-852139(-)

Full Sequence      

MAIFNDITMATARRPYTFILALLLTLLFFLYTSRVEKFSAAPPRIYTPTANEEMQLDSEY
ISGRFGFDGTWNYTRDYRNLFLSQKQCDVAFPGLFEEVERPVRLRRNKKISRKELDDTPA
LNGFIRAMIFDQQLYVIDTSGKIYSRGLATLQALHRAMLTSPEPLPNIEFTMNVDDKMEG
HPQWLYARQAHQSETWLMPEYGFWSWPETKIGSYGEMQMKALMTEASWPWDRKIDKLLWR
GATMNLEVRKKFIEMTQGKEWADVKSLDWHDEGSMKNDLKSMDEHCQYKFLAHTEGNSYS
ARLKYLRNCRSVIIAHRLEWMEFFHPLMRKDGPEQNYIEVDREFKGLEETMEDLLKRKDQ
LEEIAERSVRVFRERYLTPAAETCYWRRLIHGWKEAMGFEVEFFDVAASGEKKWRGLPVE
SFLLERRLEWDPY

Enzyme Prediction     

EC	2.4.1.-:21	2.4.2.-:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	166	395	2e-25	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	9.07e-21	92	402	7	328	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	1.42e-15	164	400	1	256	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ37094.1|GT0	2.31e-258	10	433	4	435
QSS70846.1|GT0	3.24e-99	7	428	2	450
QSS64975.1|GT0	1.29e-98	7	428	2	450
CAE7205608.1|GT0	1.23e-95	70	424	108	473
USW51979.1|GT90	7.07e-95	71	430	72	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.63e-12	83	402	17	384	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	1.92e-14	165	402	138	393	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	1.15e-12	123	402	89	394	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	1.50e-12	165	402	137	394	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	8.71e-12	83	402	29	396	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	6.05e-09	165	402	138	391	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000014

TMHMM  Annotations     

Start	End
16	35