CAZyme Information: APA10575.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA10575.1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	CP017819|CGC2	54137.82	4.8877

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017819:1764960-1766614(+)

Full Sequence      

MSKAVLPKDFIWGFATASYQIEGAPEEDGRGPSIWDTFCKIPGKIADGSSGDVACDSYHR
VPEDIALLKLTGAKAYRFSISWSRIIPLGGRDDPVNEKGIAYYSNLVDGLLDEGITPFVT
LFHWDLPDALDKRYGGLLNKEEFVKDYARYARVLFEALPKVKNWITFNEPWCSSILGYST
GLFAPGHTSNKLRSQIGDSSTEPWTVGHNILVAHGAAVKIYREEFKAKDGGQIGITLNGD
AVYPWDPEEPKDVEAAERKLEFSIAWFADPIYHGKYPDSMRKQLGDRLPSFTDEEVALVK
GSNDFYGMNHYTANYIRHRTTEPELNDYIGNLDTSFENKKGDNIGPVTQSVWLRPNPQGF
HDLILWISKRYGFPPIYITENGTSILNENDLPYPQILKDTFRADYFRNYIRAMAQAVEDG
ANVRGYLGWSLMDNFEWAEGYETRFGVTYVDYEGGQRREAKESALVLKPLFEELIKKE

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	471	7.4e-161	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274539	BGL	0.0	7	465	1	424	beta-galactosidase.
395176	Glyco_hydro_1	0.0	3	477	2	450	Glycosyl hydrolase family 1.
225343	BglB	1.22e-147	6	473	4	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	1.39e-117	2	464	26	473	beta-glucosidase
215435	PLN02814	1.20e-116	6	464	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA10575.1|GH1	0.0	1	478	1	478
ATZ54250.1|GH1	0.0	1	478	1	478
CCD54136.1|GH1	0.0	1	478	1	478
QSZ35157.1|GH1	0.0	1	478	1	478
UQC78120.1|GH1	5.49e-281	6	477	3	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.82e-274	1	478	21	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	1.98e-249	5	478	2	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.19e-246	5	478	2	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	4.38e-246	5	478	21	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.15e-245	5	475	8	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	6.02e-194	6	471	11	471	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.09e-187	1	475	1	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q7XKV4|BGL12_ORYSJ	9.43e-153	1	464	34	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	5.37e-152	1	464	34	501	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	8.55e-147	3	464	30	495	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in APA10575.1.