CAZyme Information: APA09958.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA09958.1
• CAZy Family: GH27
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		67911.25	5.8578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017818:2317148-2319329(-)

Full Sequence      

MHLSFIFFLASSSLVLARNLPKNSLHTNRNIIGSPGWSLQAETCAVGSTSCGSIAPGACC
PSNMVCAKPANSEVAACCTNASECRSVIEAAPKCADDSWNLWAGLDGNDFCCEVGLLGAY
DHISHRAGTCVSSVVVPTTSAVLRSTGTGSVVTSIPTAVSSAHITSTIVRATSSFTSDIT
SRTSLNAVATSKSPSSTVVANSNAAATEKPVFFHYMVGGINDAHCEQDIIDAIALGVDAF
ALNLAVTLDSSNSWATNTVASLFKYAQTHNFKLFFSFDMTGFTSPSQFIPILKIYVTNSA
YYYYSGQPFVSTFNGGASNFKFGQDTVNDGWKNELQAVMSASGHPIYFIPSFQDVAASSS
FFTTEYPTLNGTFNWNSWPSYTAGDVPVNTIDDVTYQNAAKAAGKGFMMGISPLQFKHID
KTQNWYRRGEANLENRFDQILTLQPDFIEFQTWNDAGESHYMGNSWPEPLVSNSTPEALS
SIAYDHRGYWQILQSFISVWKSGARSTMSMVPMNGKDAQGTFWHHTLLKGGDCAGDTLGL
GKPVGMDGVEDSVTAVVLVARGVRGLRGSIRVGGKVLGTKDLSAGFNTMVVNNISTGSVE
MSVLDAGGVVVVSGKGPLDVVDKADLCNYNFQVVGLS

Enzyme Prediction     

No EC number prediction in APA09958.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	211	611	1.6e-69	0.9893333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	3.94e-110	211	605	1	365	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	2.32e-87	205	503	1	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	1.46e-20	211	487	1	278	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA09958.1|GH71	0.0	1	637	1	637
ATZ49767.1|GH71	0.0	1	637	1	684
CCD43680.2|GH71	0.0	1	637	1	696
QRC94482.1|GH71	6.83e-109	206	637	25	444
QGA18544.1|GH71	2.21e-102	36	637	33	607

PDB Hits     

APA09958.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	5.95e-49	203	630	16	416	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	2.33e-42	203	633	30	425	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	7.74e-35	199	632	1	425	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000306	0.999659	CS pos: 17-18. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in APA09958.1.