CAZyme Information: APA09856.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA09856.1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		96970.67	5.1933

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017818:1969163-1972014(+)

Full Sequence      

MGVLSYFKISKGEKSDSSKEKSPAGPNSVVENDSPRHGFSEPSPTASSRVSLYSNNRLDD
IRHQVILNYLWQKQRGLMWIMDNSGQHEGVMVRKDRTEYLCRPPALASSTFGRAMKIMNV
SAAMTINSTVVQPFLTRSPDALDVPLTNGLRVQILPTLEDLPRARRAHYAAFIAREALLV
VWEDDPTLLFDRAKAIEDGLLQTIWTATDNEKSETLPRAQVSEVDEESGQVEERPIMYLN
SFMVGCSICLLVCIMGLGYAQLALEVVVLKHWISLCYLVMTPIYCFFTLFFTNVVIGVLM
QCFGPIQQLSRNTKFFSAKAPPRLLTTTLPHVTIQCPVYKEGLAAVIAPTISSIKKAIST
YELQGGSANIFINDDGLQLLDEATRQQRIDFYADHGIGWTARPPNGQNGYMRKGKFKKAS
NMNYGLALSNAIEEKLQDIERPATWTQVDEVAAFESCLAEVLDENPEAWAEGNIRVGDYI
LIIDSDTQVPEDCLLDAASEMEQCPDVGIIQFSSAVMQVSHNFFENGITFFTNLIYSAIR
YGVANGGVAAFVGHNAILRWSAIQEIAFEDEDGHERFWSESCVSEDFDMALRLQLKHYTI
RMAAWAGDGFKEGVSLTVYDELTRWQKYAYGCNELMFNPIRTWLWKSPFTPLFRRFICSG
IDIGSKVQIVAYIGTYYALGSAWIICVANYVFVGLWNGYLDRAYVGSWQNWLAITVVFTG
AGNVGLAVQRHRSGEKSFLPAILENLKWCFMFMIFFGGVSLHMSQALLCHMFEINMSWGA
TSKEVEFSNFFLEVPKILRTFKYTYAMCIFGIVAMIIMAEATFLPWSWNIDDFIAIFPLG
VMCASHLLLPVALNPEMMTFSW

Enzyme Prediction     

No EC number prediction in APA09856.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	479	684	6.2e-50	0.9187817258883249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.80e-47	479	685	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.80e-14	275	788	1	429	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.68e-13	337	586	4	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133043	CESA_CelA_like	3.02e-08	330	601	1	201	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
225494	MdoH	1.59e-06	472	631	228	395	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA09856.1|GT0	0.0	1	862	1	862
ATZ49741.1|GT0	0.0	1	862	1	864
CCD33801.1|GT0	0.0	1	862	1	864
QSZ29471.1|GT0	0.0	1	644	1	638
UQC83874.1|GT0	0.0	1	862	1	883

PDB Hits     

APA09856.1 has no PDB hit.

Swiss-Prot Hits     

APA09856.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999850	0.000162

TMHMM  Annotations     

Start	End
238	260
273	295
671	693
706	728
748	770
806	828
833	855