CAZyme Information: APA09513.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA09513.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	CP017818|CGC5	59019.09	6.5983

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017818:737322-739096(+)

Full Sequence      

MALPSPDIWQWAFLILWLHRYVRFIVNTISHWVYRTVPIPSNPSFTSKDVSVIIPTIHNN
FDELRDSLQSILACQPAELILVTTADKYQKLQYFSKSLEANNVSVYFAPIANKRIQVCEV
IPKVKTRILVMADDDVTWPRTILPWLLAPFEDAKIGGVGPCQRVKRVREGTFAERAFNWL
GAAYIERRNFEISATHGIDGGTSCMSGRTCAFRSEILQSPLFLDGFKTERWGQYQLNADD
DNFVTRWLVANQWSTWIQYNRECEIETTLENNFKYLYQCSRWARSNWRSNYTSLVTERHV
WHQQPWCVYALHIATFTSLSFAFDPLIIFLSFKATASWSSHHQIIAVIAQLVFMLITKVV
KLIGLFIREPKDIGFLPVSILFGYFHGWIKLYALLTLRMTSWGSRADGDANDSHRMSPRA
RRSESITLPPGNHPGLVRYKDEVQVGAPETFEKSHHTSCSEKSSCAIAPEPDLYPRLDDV
YDEFFIDESNLDSASDTSYDPNDSHDDDVFLSH

Enzyme Prediction     

No EC number prediction in APA09513.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	284	2.3e-25	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	7.55e-98	49	289	1	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
404520	Glyco_tranf_2_3	4.03e-25	49	285	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	8.15e-14	52	229	1	175	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	9.61e-11	8	430	9	433	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133061	CESA_like_1	4.03e-06	38	224	20	199	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA09513.1|GT2	0.0	1	513	1	513
ATZ50332.1|GT2	0.0	1	513	1	514
CCD48940.1|GT2	0.0	1	513	1	514
QSZ37596.1|GT2	0.0	1	507	1	506
VDB83966.1|GT2	2.09e-244	9	474	14	476

PDB Hits     

APA09513.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1RB03|GT2_GIBZE	2.44e-211	1	464	22	495	Type 2 glycosyltransferase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GT2 PE=2 SV=1
sp|G4MWY1|GT2_MAGO7	4.71e-208	2	443	27	468	Type 2 glycosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=GT2 PE=1 SV=1
sp|F9WWD1|GT2_ZYMTI	1.43e-121	9	471	7	468	Type 2 glycosyltransferase OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) OX=336722 GN=GT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999690	0.000319

TMHMM  Annotations     

Start	End
308	330
345	367
374	396