CAZyme Information: APA08823.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA08823.1
• CAZy Family: GH15|CBM20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	CP017817|CGC11	51324.58	6.2423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017817:1375285-1377282(+)

Full Sequence      

MILSKEISWSLLPVFVQAATVNYSIPSTAPTSAIKLAPAPVGLSFEFFAYPAYFKNVTAT
NQCLANFKDLSGTWPPIRIGGTTQDRATYDSDISAYVAYNVNSSVDAPASLKFGPNFMKL
ASTYPGTVVLGLNRGLNNITNTIAAAKYAKGSMKNLKAMELGNEPEYYVSDGQPIAFPSW
TPAIDAASQNNWDILVGKALGATDFIQAGNSNKAPPTWGAAELIASGNATVRTYVKDYAH
HNYPGGNVQTLMSHSGIVSNLELIGTDRKAATDVGKEYVLGETNSASGGGAATVSPTFGA
AIWTLDYALQATVLNITTIYYHHGTIGACYYCWWGQYDAGTPYYGAWLAASAFAGSSYIQ
QIDAGTTNYGIYVLYNKNKAPVKAVLINSDYYDGTGTRGSETFVLAGLKAGKETKSKRLT
AGSALSRVDRGSNPSFGGQVVANSTCVIEGEETFERVKVGSSGIAEFTVAASEALLCEHT
EWV

Enzyme Prediction     

EC	3.2.1.31:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	41	422	1.6e-62	0.9010989010989011

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	6.97e-22	369	476	2	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA08823.1|GH79	0.0	1	483	1	483
CCD49137.1|GH79	2.68e-297	1	476	1	476
ATZ50665.1|GH79	6.30e-296	1	476	1	476
QSZ32379.1|GH79	1.35e-240	11	473	16	488
AEO68155.1|GH79	4.56e-194	25	476	11	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	7.97e-141	22	476	4	456	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	1.39e-10	16	355	26	363	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	1.43e-10	16	355	26	363	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	3.38e-10	16	355	46	383	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	2.04e-30	21	476	37	538	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	1.18e-25	7	354	8	389	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.015570	0.984426	CS pos: 18-19. Pr: 0.9223

TMHMM  Annotations     

There is no transmembrane helices in APA08823.1.