CAZyme Information: APA08732.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA08732.1
• CAZy Family: GH135
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537		58649.49	4.4449

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017817:1043753-1045443(+)

Full Sequence      

MKTQSLISMGLLPILSVNAAYTWPSKYDELEDILYLQAGYRRYGFRDGVTPCGFSADGSN
RETAAEWIKTAYHDMATHDVETGLGGLDASIAYELGRAENPGSAFNGTFGFTNNYASIKS
SNSDLLAMSVVVASMACGGPIIPFRAGRIDAVQAGVPGVPQPDQDLATHTAIFAKQGFNT
TEMITMVACGHVLGGVHGVDFPQITGDNNETSFPHFNSQYDNFTNSIVTEYLEDKSIDVL
VVGKNDTFNSDKRIFGADNNKTMTSLADPSNFQAQCRDIFARMIDTVPASVTLSEVITPI
EVKPTELSLALGANNTLSFTGSIRVRTTHRNADNVTVSLRYRDRNNNLSNTTISTERGRW
QLGQSYGFAREVFTFYEFDTAFDVTSSISSFDVIIHTAGEADEINTNNGLGFPVSDAILL
QAPQSCQPQIIVNEAGQWNLTITAAVRADRVGEPVAFDWVYKRFIQGVMINQLEVQRTVM
EKASEEIGGYYLYTATKPIDTVQWSTTFDLVLGEGDNVSKLEFLSTGNLASTCQPFP

Enzyme Prediction     

No EC number prediction in APA08732.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	57	232	3.3e-20	0.6705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	6.87e-132	23	285	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	3.74e-22	55	284	9	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	8.13e-16	60	197	12	155	Peroxidase.
173825	ascorbate_peroxidase	1.53e-11	71	235	37	197	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178467	PLN02879	5.49e-08	68	197	38	169	L-ascorbate peroxidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59397.1|AA0	1.08e-116	1	533	1	529
QGI68923.1|AA0	2.94e-110	1	533	1	529
QRW22025.1|AA2	5.64e-106	18	536	16	538
QBZ57066.1|AA0	1.72e-104	1	536	1	538
QRV94524.1|AA2	7.00e-103	14	536	13	535

PDB Hits     

APA08732.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	4.95e-81	17	536	17	515	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	3.63e-08	64	194	114	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q4WLG9|CCPR2_ASPFU	2.61e-07	67	213	32	185	Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_6G13570 PE=3 SV=1
sp|P0CP54|CCPR_CRYNJ	4.38e-07	68	197	133	267	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CCP1 PE=3 SV=1
sp|P0CP55|CCPR_CRYNB	4.38e-07	68	197	133	267	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002784	0.997178	CS pos: 19-20. Pr: 0.9653

TMHMM  Annotations     

There is no transmembrane helices in APA08732.1.