CAZyme Information: APA08244.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA08244.1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		41246.38	8.2188

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017816:2674880-2676239(+)

Full Sequence      

MYSLLFWFAAALFTSVHGANDTGSAPGAAQGVTGGGNATPVTPTTTAQLISYLTDSSPRV
ILITKTFDFRGSMGTTTAAGCIPSSNTCGSSGQNAINANGWCGSSPKTTVSYDNAGTTAI
LVKSNKSIIGVGSAGVIVGRGLNLKGVTNVIIQNIHITNLNPSLIWGGDAITLAGTDLIW
IDHCKFSLIGRQMLVTGYQAAGRVTVSNNEFDGKTSWSSSCNNQHYWTMLFLGASDYITL
LNNYVHDCSGRAPKVGGSGTIYMHAVNNYFASIDGHDFDVAKGGAVLMEGNYFKTVKTPI
TAASSTAGGSIFNAVAGTESSCSASLGRACFSNAADGSGKITAFSKTDFFSSFKSKGMSS
FPAAIAASGVPAYVMANAGIGKIKGGVEARDRAVDSEVCY

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	109	294	2e-88	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	6.91e-43	107	293	1	186	Amb_all domain.
226384	PelB	6.48e-18	107	325	82	305	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.73e-14	118	293	28	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA08244.1|PL1_4	1.41e-283	1	400	1	400
ATZ48538.1|PL1_4	1.41e-201	1	383	1	385
CCD51274.1|PL1_4	1.41e-201	1	383	1	385
QSZ35825.1|PL1_4	3.54e-192	1	383	1	383
AIX03726.1|PL1_4|4.2.2.10	7.84e-111	22	386	25	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.49e-92	19	382	1	359	Pectin Lyase B [Aspergillus niger]
1IDK_A	5.04e-89	22	383	4	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.13e-87	22	383	4	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1VBL_A	1.02e-08	120	293	128	330	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	4.78e-119	9	386	11	383	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	8.12e-111	22	386	25	386	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	8.12e-111	22	386	25	386	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.04e-110	9	386	11	385	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	1.04e-110	9	386	11	385	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999691	CS pos: 18-19. Pr: 0.9817

TMHMM  Annotations     

There is no transmembrane helices in APA08244.1.