CAZyme Information: APA08036.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA08036.1
• CAZy Family: GH12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
890	CP017816|CGC6	95066.83	6.1462

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017816:1965919-1968775(-)

Full Sequence      

MKQITNFLLIHILAAIASGAPHPHPEEQKNHHPPREAPTFGPGAPLFPQSLVKVPQWLTT
KQEFQPKSIFPDVISSDGFIFLSPPGAILSSSITTTAVIPSVSVLTTSSISGTVQVTVQV
LPSPSTQTPATTGSVISSLETSGHATVPPILTSSIPSPTTQLAPTAPTPVNHMMNTVAAD
SNIFQPIDTSPPPSNLGTRSDHPVPRLGIKSQRAPRDTNKFYANFFLGSQTAPAWTHPYS
LAWSKGGGATKSWGMTIVHIDADQRVFGPNAAANPASYFINPIGIQSLVLSATQLGATTT
LTTDTLTALSVNVNLSPSPGADPTIVFPLVQGMGFVTAIFAGATPTLQSGILFRTLALDP
TPPKSGITKYSILLEDGKTWLLYAYSPSGQNLALTVVNNGLVQATSGFNGIIQIAKSESS
AHEAMFDEACGAYPISASLSGHVNGAVGSYTIAFNKGGLSSTTLAMFALPHHLESFDNNT
ICGVINGVQLATTTKGMATAIVADSWTLEEDLPLSLNFAPWSPARGSSNSISAAAISTIA
GIAASEISQNMTAQTDLNSMYYSGKALAKFAGIVYTLHDFVGNTALAQAGLNTLKQNFAL
FVNNKQQFPLVYETAWGGIVSTASYVTGDSGVDFGNTYYNDHHFHYSYFVYAAAIIGYLD
PSWLAGNKAYINAMVRDYANPSTADNYFPVSRNFDWYHGHSWAHGLYETFDGKDEESSSE
DSLSAYAIKMWGRTIGDSNMEARGNLQLAITARSLQNYFLYESSNTVQPANFINNKVSGI
LFENKIDHTTYFGGAPELVQGIHMLPLLPHSTLTRTEEFVTEEWNTYFSNGRADQVVGGW
RGVLYANLAIINPRTSWNFFAQAGFDASWLDGGASRTWYLAMAAGLGGSP

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	202	881	1.3e-219	0.9887459807073955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	141	890	15	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	530	880	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	6.97e-138	202	523	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
215130	PLN02217	1.40e-04	57	215	495	646	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA08036.1|GH81	0.0	1	890	1	890
ATZ48291.1|GH81	0.0	1	890	1	866
CCD51604.1|GH81	0.0	1	890	1	866
QSZ30780.1|GH81	0.0	157	890	29	762
VDB90415.1|GH81	0.0	8	885	6	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.15e-92	182	884	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.95e-92	182	884	32	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	8.14e-91	218	884	43	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.69e-23	561	863	340	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	7.86e-16	561	806	361	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.08e-261	122	885	139	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	4.28e-180	182	890	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.44e-161	180	886	44	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.53e-160	182	889	401	1115	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.74e-152	182	885	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999759	CS pos: 19-20. Pr: 0.9824

TMHMM  Annotations     

There is no transmembrane helices in APA08036.1.