CAZyme Information: APA07946.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA07946.1
• CAZy Family: GH12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		37720.39	8.2480

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017816:1657933-1658970(-)

Full Sequence      

MRRGTLIFLVINFIIIGFLVNAFSTLISLLFTDGAADAIHRSEIPAPGSELIETRPQLIP
KIIHQTYINSSIPERWKAGQQSCIDLHDDYEYKLWTDEASRAFIAAEYPWFLDTFDSYPF
PIQRADSIRYFVLAHYGGIYIDLDDGCNRRLDPLLSYPAWLRRTIPTGISNDAMGSVPQH
PFFLRVIESLQSYNRNWGMPYITVMYSTGPLFLSVLWIEYMRTVTDEAGRVRNLMPDEYN
KHAWSFFNVVKGNSWHGKDAQTIFWMGKHWLLLTVTGFAIAGIVGGCLWFAWNMWVVRSS
KSHRRGMALWRRVSGKDRYELLDRVA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	74	155	9.1e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.91e-79	57	293	80	318	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.97e-27	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07946.1|GT32	9.67e-249	1	326	1	326
CCD51739.1|GT32	5.09e-235	1	324	1	324
ATZ48182.1|GT32	5.09e-235	1	324	1	324
QSZ30681.1|GT32	4.12e-225	1	326	1	326
BCS17906.1|GT32	6.40e-167	1	305	1	305

PDB Hits     

APA07946.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	5.18e-105	1	278	1	282	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.32e-101	26	278	26	274	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.79e-89	50	284	48	283	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	9.04e-88	37	280	56	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.84e-53	59	269	64	275	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.551075	0.448924

TMHMM  Annotations     

Start	End
7	29
196	218
270	292