CAZyme Information: APA07854.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA07854.1
• CAZy Family: GH10
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	CP017816|CGC10	60848.36	7.6114

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017816:1366134-1367970(+)

Full Sequence      

MPFFRRAYLFLLLLRLWFAISPSYLHPDENFQGPEVIAGQIFSYPVKLTWEFTSENPIRS
VFPLWPIYGLPMLLLRWLWIGNGNDGEIPPIAVFFALRLLMLTLSFVLEDWAIHELVGSP
RHRKIAVLLVASSYVTWTYQTHTFSNSIETLAVAWSLVLIQRIAEAKKHSSVIPCGILAF
VVVFGIFNRITFPAFLFIPGLRLLPHFIRKPLSLISMILFGSIATFIAICLDTNFYAKVP
VTWSYLFSHPTITPFNNLNYNLATDNLALHGLHPWYQHSLVNLPQLLGPATLLLLQPLAS
LRLFSAISGVVVLSFFKHQEARFLLPTIPLILSSVKLPKQKIPLRIWGGLWISFNMLLGL
LMGVYHQGGVVPTQVFLSKQLDATHAIWWKTYSPPIWLLNGKNEVLDTHDLMGIKGELMI
EEVTKLATCLPKFGEELLEATYLIAPTSATFLDKYTANQTDLYFEGVWKYEKHFNLDDMD
FGDDGFWNTITRVIGRRGIAAWRVTMDCSEEKKDMNKVEDISREGESSQEWKV

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	8	398	2.6e-79	0.987146529562982

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	4.19e-45	17	397	12	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	0.005	23	380	58	426	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07854.1|GT22	0.0	1	533	1	533
QSZ35572.1|GT22	0.0	1	528	1	529
ATZ47912.1|GT22	0.0	1	528	1	529
CCD44011.1|GT22	0.0	1	528	1	529
UNI14407.1|GT22	1.04e-267	5	508	3	515

PDB Hits     

APA07854.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	2.50e-257	5	508	3	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	2.17e-184	5	503	3	536	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	5.62e-178	5	502	3	539	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	3.03e-172	5	502	3	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	2.82e-93	12	480	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.026457	0.973499	CS pos: 25-26. Pr: 0.3723

TMHMM  Annotations     

Start	End
61	80
90	108
170	192
212	231
346	368