CAZyme Information: APA07712.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA07712.1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		66451.59	4.4915

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017816:881257-883256(+)

Full Sequence      

MFTKDFTVAGLAALSLVAQSQAGPTLGTSHLKARALLGTSFGVPGRNATYDYVVVGGGNA
GLTIAMRLAESNSGTVAVVEAGTFYEISNGNISQVPATDGVFAGKGASDWQPQIDWGYQT
TAQSGAYNTSLHYARGKTLGGCSARNFMVYQRGTAGSMQKWADQVGDDAYEWDNFLPYFQ
KSVNFTAPDMSLRSANSTPQFVAAEAANAPATGPLSVTWSHYAQAFGTWAIEGLAQIGIP
VIPGFLGGSLIGSSYPTFTLDAERMTRESSETSFLRAGMKSPDLKVYTLSMAKKILFDDT
KTATGVLVETGGYPFTLTANKEVILSAGVFGSPQILMASGVGPAAELSAIGVDVIADRPG
VGKGMQDHIFTGIAYRVNAPTISKLGNDPAFAAEQAALYENTPASGMYSSPNTDVLGWEK
IPEKYRSEWSNETQTALAAYPSDWPEVEYIAISSFLGNQVVLGSDPSDGYNYATLSVALV
APRSRGSLTITSPDTNVAPIIDPGFLTEQSDVDIMVAAIKRIREFYATDALQSFVIGDEY
FPGSNVSTDAQIESFVRTSFNTIWHATSTCSMGPVNDTNTVVDTQARVLGVSGLRVVDAA
AFPLLPPGHPMSTVYAFAEKIACDIIGC

Enzyme Prediction     

No EC number prediction in APA07712.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	49	626	2.1e-178	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.12e-96	49	626	5	531	choline dehydrogenase; Validated
225186	BetA	1.17e-89	46	622	4	530	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.37e-40	482	621	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.32e-29	1	614	1	565	Protein HOTHEAD
366272	GMC_oxred_N	1.66e-23	134	368	22	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07712.1|AA3_2	0.0	1	628	1	628
ATZ47873.1|AA3_2	0.0	1	628	1	628
QSZ35459.1|AA3_2	0.0	1	627	1	627
QGA12464.1|AA3_2	5.10e-298	29	627	16	611
AUS76865.1|AA3_2	4.67e-213	7	626	6	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.70e-62	50	626	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.28e-62	48	626	1	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	5.16e-59	50	619	41	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	6.27e-59	47	626	3	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3NNE_A	3.04e-55	50	626	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	3.79e-236	9	627	15	626	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	2.02e-233	3	627	4	626	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.37e-180	35	626	21	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.21e-156	47	626	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	8.77e-147	27	626	22	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004636	0.995331	CS pos: 22-23. Pr: 0.9592

TMHMM  Annotations     

There is no transmembrane helices in APA07712.1.