CAZyme Information: APA07678.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA07678.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626	CP017816|CGC15	66368.65	3.7389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017816:804256-806439(+)

Full Sequence      

MAIGSHRLIAALLAISHFANSHFVPHPTSQRHERDTDAAAAFTGFSIFSSGSLSSLNLTS
TCEAALYQTVYCDDDTSSLLTDGYVDSFDNSTEEALFCDAGCESSIAKLHDSVLAACGDT
EGLLEGLPFLGIVDEFWSNWNQSCFTDPTTGENCNDVVAAFSNVTDLSDIPISDLCSYCN
VHMLEMMQADAYTDVYNDNWVTTYQYVADACNLTVADFNATASAFNVTGVISTTTNCVSG
ITYTTVEGDTCDSIALAKGVSAATMYYINSDINNCSSVTVGATLCLPLTCTDLYTVQEND
TCTSIAVNAGLLTANVISYNSHINWNCSNLHSTDPYWGSTLCVSTPGGTYTGQAMNTTAT
SDVAVSAPAGSTVALNSTTDCGEWYANDGSSNLTCAQICLSYEIAINLFTEANTSLNKTT
CDNDLVLGNAYCVDPLTGWDWTATASSSSSSTTSTAPSSTSIVTAPGPTQTGITSACNNY
YVTVDGDSCSSIETAYDITLAQFYAWNPAIGSDCTNLWLEEAYCVGVYGSTVTTVTAPGP
TQTGIISSCTEYYVTVAGKSTPEFSATLIRLLTRGMGIQVILALQLNQYMILPGLNFMLG
ILRLGVIAQTFGLRKHTAFPFLDIPL

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.67e-08	480	518	2	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	4.83e-04	480	525	1	44	Lysin motif.
396179	LysM	6.69e-04	294	343	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
212030	LysM	8.60e-04	241	286	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	0.001	294	343	2	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07678.1|CBM50	0.0	1	626	1	626
CZS74850.1|CBM50	3.12e-167	43	527	25	523
CEF83616.1|CBM50	8.86e-167	43	527	25	523
QKD59081.1|CBM50	5.01e-138	43	563	25	522
QKD61253.1|CBM50	5.01e-138	43	563	25	522

PDB Hits     

APA07678.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AVW3|LYSM5_ARTBC	4.71e-16	98	527	84	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4ALG0|LYSM1_ARTBC	7.69e-15	395	558	167	332	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B5F9|PGDA_ARTBC	1.43e-10	469	527	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4P8|LYSM2_ARTBC	1.76e-10	385	529	31	183	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AY86|LYSM6_ARTBC	4.14e-09	466	525	360	419	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000460	0.999524	CS pos: 21-22. Pr: 0.9666

TMHMM  Annotations     

There is no transmembrane helices in APA07678.1.