CAZyme Information: APA07504.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA07504.1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		38061.70	7.7941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017816:178646-179930(-)

Full Sequence      

MVNLSVLATFLASSALVASAPSPAPEDLDKRADCTFTSAATAIAQKKGCSTITLNNVAVP
ANTTLDLTGLTTGTKVIFQGTTTFGYYEWEGPLVSISGTDIVVTGAAGNKLDGGGARWWD
KLGSNVTPGNGKVKPKFFAAHKLLGSSSITGLNFLNAPVQCISVGQSVGLSLININIDNS
AGDTNQLAHNTDAFDINLSQNIYISGAIVKNQDDCVAVNSGTNITFTGGNCSGGHGLSIG
SVGGRSGTGANDVKDVRFLSSTVSKSSNGARIKTVSGKTGTVSGITYQDITLVGITGYGI
VIEQDYENGSPTGTPTSGVPITGVTMNNVHGTVTGGQNTYILCANCSGWTWNKVAITGGT
VKKTCKGIPTGASC

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	44	367	2.4e-65	0.9446153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	8.44e-113	49	374	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	5.40e-25	148	353	169	365	polygalacturonase
177865	PLN02218	4.71e-22	100	366	157	416	polygalacturonase ADPG
178580	PLN03003	1.48e-20	107	332	119	330	Probable polygalacturonase At3g15720
227721	Pgu1	1.22e-19	91	304	189	408	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07504.1|GH28	2.44e-264	1	374	1	374
ABP88747.1|GH28	3.36e-223	1	374	1	374
CAM91337.1|GH28	3.36e-223	1	374	1	374
ABP88745.1|GH28	3.91e-222	1	374	1	374
ABP88746.1|GH28	3.91e-222	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KVE_A	1.74e-141	24	374	1	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.00e-140	24	374	1	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	5.80e-138	32	374	1	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
2IQ7_A	9.25e-133	32	372	1	335	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]
1IA5_A	7.53e-117	34	374	4	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12708|PGLR1_SCLSC	1.90e-141	4	374	5	380	Endo-polygalacturonase OS=Sclerotinia sclerotiorum OX=5180 GN=PG1 PE=3 SV=1
sp|O93883|PGLR_PENGR	1.10e-134	28	374	33	376	Polygalacturonase OS=Penicillium griseoroseum OX=84562 GN=PGG1 PE=3 SV=1
sp|Q00446|PGLR1_COLLN	1.08e-131	22	372	18	359	Endopolygalacturonase 1 OS=Colletotrichum lindemuthianum OX=290576 GN=PG1 PE=3 SV=1
sp|P26215|PGLR_COCCA	1.59e-131	1	374	1	364	Polygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGN1 PE=3 SV=1
sp|P49575|PGLRA_ASPPA	8.19e-129	14	374	15	363	Probable endopolygalacturonase A OS=Aspergillus parasiticus OX=5067 GN=pgaA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999746	CS pos: 31-32. Pr: 0.9137

TMHMM  Annotations     

There is no transmembrane helices in APA07504.1.