CAZyme Information: APA07494.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA07494.1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	CP017816|CGC1	91617.74	5.5319

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017816:147555-150209(+)

Full Sequence      

MTNRIDVEDVLSKLNNLEKVSLTAGASWWQTTAIPKYNVPSIRVSDGPNGVRGSRFFNGI
KAACFPCGTALGATWDTKLLHRAGVLMGEEAKAKGVHVILGPTINMQRSPLGGRGFESLS
EDPVLSGLGAAALVNGIQETGVQATIKHFVCNDQEHKRNGVNVIITERALRELYLLPFQL
VVRDSKPALFMSAYNKVNGTHVSENIRILKDILRGEWGWDGCIMSDWWGTYSTTGAIMAG
LDLEMPGPTKWRGPLLIQAVSTGKVPQHILDERARNVLKLVDRAADAKVPENAEEKPADT
PETAALLREIAGDSIVLMKNEGNALPFRRDKKTLIVGPNAKVSTYHGGGSASLAAYYAVT
PFDGISAVLESAPSYTVGAYSHKDLPLIGLLLKTDKGETGVSFRAYNDPPTVKDRELADE
IILTKTELLMMDYFCTKLKDELWWADVEGYMTAEEDCDFELGLGVYGTANLFVDGKLLID
NSTKQTRGTMFFSCGTVEERGIISLKKGQTYHIKVEFASAPTCKLDKGDNVLFGPGALRI
GGAKVLDADEEIAHAAELAKEADQVIICAGLNSDWEAEGADREIFGLPLHMNKLISALTP
VNPNTVVVIQSGTPIALPFLSTTPALLHAWYGGNETGNAIADVIFGKMNPSAKLPLSFPK
RLEDNPAFLSFRTERGRVIYGEDVYMGYRWYETIDLPVLFPFGHGLSYTTFSLSNLNVQK
IDKKIKVSVKVKNTGKLPGGEVIQVYIRQQNPSIRRPKKELKGFEKVFFEAGEEKSVDVE
IEIKYAAAFWDEVREAWIVEKDTYEVIVGNTSEEGKGELRGVFEVEKTEWWNGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	246	1.7e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.44e-66	29	350	50	379	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.05e-60	65	809	120	751	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	9.75e-49	315	708	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.14e-38	52	280	78	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.63e-28	38	783	97	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07494.1|GH3	0.0	1	834	1	834
CCD50485.1|GH3	0.0	1	834	1	833
ATZ56815.1|GH3	0.0	1	834	1	833
QSZ32943.1|GH3	0.0	1	834	1	834
UQC84651.1|GH3	0.0	6	834	5	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.33e-261	3	834	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.80e-256	3	834	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.33e-134	5	812	3	657	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.24e-114	8	812	3	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	8.60e-99	34	797	87	802	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NDE2|BGLI_ASPFN	0.0	4	834	3	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	0.0	4	834	3	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	4	834	3	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	4	834	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	0.0	4	834	3	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999883	0.000138

TMHMM  Annotations     

There is no transmembrane helices in APA07494.1.