CAZyme Information: APA07096.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA07096.1
• CAZy Family: CE12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	CP017815|CGC16	85386.26	4.5400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017815:2440359-2442870(+)

Full Sequence      

MNLVWAFPLFILDFVQAQADYSQYVNVFTGTQSGGNDFPGVARPWGMVKLGPDLLIQGTD
SYSGYLPNGNFSGFSLMHEQGTGGAPKYGTVAQLPLVGTITNPLSGITVGRAVPDQGSVG
YYRAQTSDNVVVELAATSHAGLYQYTFPTTSTANKILIDVSHVLPSFRGQGLGQGYDGGS
FQIFPDGHYEASGVYNNGWNRSPDWTIYSCGYFNVTPSASNVYTNTGAGSVLQPSKSATA
ANLDTAVGGLYTFNTTAVASRVGISWISKEKACQNVNNEIPHDTIFSTVVSDTKSVWNNQ
VLSRITTTSTNSTNLGLLYTSMYFMNLLPTNQTGENPKWTSTEPYYQDIFTLWDLFRCST
ALFHVLQPTAYEEYIRSLIDIWRHDGYMPDARSSNYNGRTQGGSNADNVLADAYVKGVRG
QINWNDGYAAMVKDAEVQPNNTVPPDPMAPDSSTKEGRGALPDWKKYGYITPTYSRAGSR
AVDYAYNDFSLYQVASGLGKTDDAAKYLARSRNWRNHWNHNLTSIGYSGFVVPRTAPNSS
TPFVPVNPLLNDGYWGDPFYEGSSWHYSWGDIHDMDTIIEYMGGDATFYDRLDTMFTVGA
NPNDPQGIIFDGTNEVTFNVPYLYNFINNQSRSTYQSRKVAKTYNLSPSGLPGNSDAGAM
QTWLIWNILGLYPITATPNFLITSPWFESTTIDLGPSDSAPYDRKKLTITSTGGDGNGDN
DIYVQSLKVNGVLWDKNWVTWSDVFENGGVMEFVLGSEPSDWDGDGERVPSPASETAAG

Enzyme Prediction     

No EC number prediction in APA07096.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	248	759	1.4e-139	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400362	Glyco_hydro_92	3.92e-168	271	757	1	465	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
226067	COG3537	5.74e-123	5	773	31	757	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
407572	Glyco_hydro_92N	1.04e-50	24	265	1	231	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.
411518	lectin_1	5.55e-42	25	762	11	688	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07096.1|GH92	0.0	1	779	1	779
ATZ46045.1|GH92	0.0	1	779	2	780
CCD45752.1|GH92	0.0	1	779	1	779
QSZ31268.1|GH92	0.0	1	775	1	776
QMW36403.1|GH92	0.0	1	774	1	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F8Z_A	1.46e-59	20	762	6	717	Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F90_A Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
2WZS_A	3.02e-50	20	760	2	719	Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_G Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_H Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482]
2WVZ_A	3.21e-50	20	760	2	719	Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVZ_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVZ_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVZ_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_A Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_G Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_H Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW1_A Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW1_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW1_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW1_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_A Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482]
2WVY_A	1.53e-48	20	760	6	721	Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVY_B Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVY_C Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_A Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_B Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_C Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
2WVX_A	3.94e-45	20	760	2	719	Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVX_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVX_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATR3|A7629_ARTBC	5.70e-91	16	773	25	757	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1
sp|O86365|Y584_MYCTU	1.99e-39	23	760	43	754	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999751	CS pos: 19-20. Pr: 0.7187

TMHMM  Annotations     

There is no transmembrane helices in APA07096.1.