CAZyme Information: APA06830.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA06830.1
• CAZy Family: CBM24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734	CP017815|CGC6	80091.43	4.8447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017815:1517553-1519920(+)

Full Sequence      

MFSPSSLFRELHLIPLFLRIFIFTNLVNSLPRSSTYQNQNQHPSKKYASAIPNWHKYVRA
PSSSVIAPQGIANMSGEVTNPDALLQRGGQVTTLTRANGSANIPSITVDFGQNMAGYLSI
NFAGASKTPPGIRLAFSERLEYISDVSDFSRSNHGDSITPGSDQISVANQSYTWKDEHGC
QYGTKVCADGIHGFRYIRIFLDALPEDAPYTVPYGTVAIDYLSLKFSGVRGTPDTFTGWF
ESSDEDLNQWWYDGVYTNDIATDIFTLNSTEPRNAFSLTLDGKLVLMDGAKRDRDPYVGD
IAVAGKTLFLSHNKPEASRNVLADLADHQRADGWIPPASIAGYELHLLDYPLWWIVSSYD
LLMYTGDNDYIRKYYPNLVKCLDVFYPSVTDAGTTLIWKGVGVSGDYGDYAFLPRIGPVT
YYSALYVLALENAAAIAKSQGQSADASRWLARAKVVSDALNSHNFDNSVGAFFDGGCGNG
LCNTHSQDGNSISILAGVTNTSRSTSILNYLNSANRRFYGNSFYDNDVLSDGFSQRVYAF
ISFFEISARFKTNLVSSAFDEIRRLYGWMANNDPKITMWEGIGANGSAYQGGFTSMAHGW
STGIVPEMSNYVLGVIPTGPGFSTWSVKPYPGDLSWAKGQVPTPHGPIIVDWSINSSGWF
VLSVDAPVDTTGTVSLPVQFGASAKADSVLEISVDGEMAWDDGPVAFDAVLDASDGYVSL
VLQGGTTHTITVKV

Enzyme Prediction     

No EC number prediction in APA06830.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	105	676	4.6e-92	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	6.96e-17	614	679	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	7.21e-15	237	498	3	237	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	7.56e-08	315	463	302	460	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
407295	Glyco_hydro_36	4.57e-06	307	513	60	305	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
283786	GDE_C	4.87e-06	301	474	37	220	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA06830.1|GH78	0.0	1	734	1	734
ATZ46524.1|GH78	0.0	1	733	1	738
CCD34287.1|GH78	0.0	32	733	10	719
QSZ35275.1|GH78	3.06e-295	241	734	1	499
QYT03284.1|GH78	6.76e-253	53	733	29	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.43e-20	349	677	628	942	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	1.26e-18	106	650	194	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

APA06830.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.029965	0.970009	CS pos: 29-30. Pr: 0.9226

TMHMM  Annotations     

There is no transmembrane helices in APA06830.1.