CAZyme Information: APA06712.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA06712.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	CP017815|CGC8	48105.66	9.6954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017815:1115579-1116921(-)

Full Sequence      

MALSTSTLFTLAIILRIILFTYGLYQDLHSPLKYTDIDYHVFTSASHYTSQSHSPYTRET
YRYTPLLAWLLLPTTFTPAFIFFHFGKIFFAFCDIVAGYLLHVILMGRGMDAGRAGKYAA
IWLLNPMVAAISTRGSSEGILGVLVLGLLWAVLERRVGFAGFLLGLGVHFKIYPVVYGVS
IVWFLDRETMGGLKSRKVSGKGKKVIKEGGEKSSEDVWGKITGFINSERIVLVTTSLMTF
MSLNALMYYIYGYPFLQHTYLHHVTRIDHRHNFSPYNTLLYLRSAVPSPTPLALESLTFI
PQLLLSLLLIPVTLSRHDLPSTMLAQTLAFVTFNKVVTSQYFLWYTCLLPLYLSTPSCTL
VRSPRVGVLAAALWIATQAFWLQQAFELEFLGISTFVPGLWVASLLFFATNVWILGIIVR
DVGRGAAAV

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	131	418	5.6e-94	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.51e-87	2	420	5	416	GPI mannosyltransferase
252941	Mannosyl_trans	5.86e-64	131	419	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA06712.1|GT50	3.78e-305	1	429	1	429
ATZ46220.1|GT50	5.98e-243	1	429	1	427
CCD45947.1|GT50	1.21e-242	1	429	1	427
QBZ54528.1|GT50	9.03e-156	4	422	24	427
BCS05340.1|GT50	2.11e-155	4	426	14	423

PDB Hits     

APA06712.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WAH2|GPI14_ASPFU	6.08e-158	4	426	7	425	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	1.32e-154	6	422	9	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q7S4Z3|GPI14_NEUCR	3.04e-153	8	424	29	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	3.96e-153	15	423	18	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	8.38e-150	3	424	8	410	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.972478	0.027536

TMHMM  Annotations     

Start	End
7	26
61	83
88	110
130	152
159	181
230	252
293	315
330	352
365	382
397	419