CAZyme Information: APA06478.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA06478.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
973		105856.56	6.5825

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017815:320599-324121(-)

Full Sequence      

MDVTEEELDPLWKDLDWAMGQCFMMGFEGTEVTPQIRTLIEDHHLGAILLSTKNMKSARE
TANLVQELQTIAHQAGHLVPLIIALDQENGGVNSLFDEDYICQFPSAMGMAATGSPELAY
EVANATAKELSAVGVNMIMGPCLDVLTNARYQPLGVRATGDDPQEVSQYGIAAMNGYKDA
GIATCGKHFPSYGNLDFLGSSLDMPIITETLEQLSLGALVPFRNAIREGMDSIMVGGCAI
ANAGMNVMHACLSDQVVDDLLRNDLGFNGVVVSECLEMEALSHDIGVRGGTVMAVEAGCD
MVLLCRSYSVQREAIAGLKLGLENDMISRERINLSLKRVLKVKSQCTSWTKALNPPGINH
LASLHPHHLALSTKAYDHSITIMRDKGHLLPLSNSYSEDDDDLLLLTPLVKPLPASTATF
NNENSKSTNTESEKSHRSSIMSGEGVFRELGRALARQRHGRLLHTSYTANGVRPVHENLI
NRAGTIIIITADATRNLYQNGFTKHVAMMCSMLSSAGKKKSLIVVSVSSPYDFAMDKSIG
TYVCTFDFTETAMKALVRALFGDFVPQGTLPGTLRKSRKVQKSRQHWLVESYNRDRDARG
LQALITSIEKTTPPNQQPALAGATADSFELPPASNNTPLEESHYVVRNSSTQALFGFCST
TYSPSTHTGTISTLFVDPSKRNLSIGHSLHQRALRHLLQKPNITHLQLGSTLPAIYLGIP
MSDLTEGARLKHWFATNGWDVLTPRFLYTLIIRNLALWTPPEGLLATIERVSLQFDLIHG
PSNSATQVLDFVQTHSSSVEIHSLYNLAIMDPKSCGIVRAKSPIDGSLVGTVIISRSDTL
LSRWMPVLSSSPSSYSHSNSGSNSNSHINPNNGKGKEKEDNRGNGKGNGNGNAVGGILAP
IIPSNNAQREMILQGLVMLSIRQNKNKGDGKGVVLNWVVGGDRDVLLGMGFDVLEAWEEV
VCSVERWSEMNLG

Enzyme Prediction     

No EC number prediction in APA06478.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	303	4.4e-54	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	6.77e-70	24	393	9	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.91e-57	15	342	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	3.31e-35	24	338	5	308	beta-hexosaminidase; Provisional
185053	PRK15098	1.62e-11	34	343	66	353	beta-glucosidase BglX.
178629	PLN03080	4.89e-06	104	573	114	587	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA06478.1|GH3	0.0	1	973	1	973
ATZ46390.1|GH3	0.0	1	973	1	961
CCD43026.1|GH3	0.0	57	968	80	979
VDB95027.1|GH3	0.0	19	965	1	916
QBZ62649.1|GH3	0.0	1	970	1	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	9.42e-87	14	739	8	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	7.16e-64	15	574	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	7.32e-44	15	571	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	9.52e-44	15	571	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.41e-43	15	571	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.76e-43	15	571	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	8.79e-32	24	318	7	296	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|P48823|HEXA_PSEO7	2.37e-31	30	395	49	428	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q82SJ8|NAGZ_NITEU	2.18e-29	24	318	7	296	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
sp|Q2Y863|NAGZ_NITMU	6.12e-28	24	318	7	296	Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in APA06478.1.