CAZyme Information: APA06425.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA06425.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		25229.42	4.6526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017815:124002-124979(-)

Full Sequence      

MKFSVSLLLSLSSIALALPVAETEVRSEAVADKTTTDHLASTAHFFEESAVVAAAAASAT
PSVVTTENGLTTDACKPVIVIFARGTNEEGNVGQDVGPYVFTDLRASLTSAKVTVQGVDY
AANVLGYLEGGDPTGSTTMANLTNTAAAKCPSAKLVLSGYSQGAQLVHNAAKTLSAAVTA
RIAAVVMFGDPDNGQAVGTVPTSKVLSICHNQDIICTKLGWFTTHLTYSEDAQTASDFIV
NAVGAV

Enzyme Prediction     

No EC number prediction in APA06425.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	74	242	3.2e-44	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.67e-58	74	243	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA06425.1|CE5	1.12e-157	1	246	1	246
ATZ46322.1|CE5	9.97e-124	1	246	1	235
CCD42307.1|CE5	9.97e-124	1	246	1	235
QSZ35346.1|CE5	1.61e-96	1	246	1	244
VCU39288.1|CE5	1.20e-56	25	240	18	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	3.44e-40	66	243	74	247	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
5X88_A	2.65e-21	67	239	15	194	Chain A, cutinase [Malbranchea cinnamomea]
3GBS_A	6.91e-21	64	244	10	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
1CUZ_A	7.11e-21	74	246	30	210	Chain A, CUTINASE [Fusarium vanettenii]
1FFC_A	2.69e-20	74	246	30	210	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8X1P1|CUTI_BLUHO	3.03e-57	66	243	58	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|Q8TGB8|CUTI_MONFR	1.27e-50	74	245	30	201	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	5.95e-49	62	244	17	201	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q9Y7G8|CUTI_PYRBR	4.98e-45	75	238	32	196	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	3.56e-44	63	239	71	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000324	0.999653	CS pos: 26-27. Pr: 0.5580

TMHMM  Annotations     

There is no transmembrane helices in APA06425.1.