CAZyme Information: APA06410.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA06410.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	CP017815|CGC20	31731.15	4.0403

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017815:64978-65865(+)

Full Sequence      

MKTTSIALALASTLTGANAYWKGFNSQATLGNGACKTQADWENDFRMIQSFPGGFNSLRV
YASSDCNTIANVVPAAIATGGKVLVGVWTEDAGHYDAEKQALLAATRTYGFDWMVAVSVG
SEDLYRGDTDAFTLSQQIYDVRGMLSTVPGYTTTGVQVGHVDTWTMWTNGANVDVIKACD
FIGLDGYPYFQNTEENDIGVADDLFWQSVNAVRGAVQNVGSNAPVWVTETGWPTAGATEN
VAVASVENAQTYWKQVACSAVNEVNTFWYSLQDFNAIPAFGVVDGNGNLKYDLSC

Enzyme Prediction     

No EC number prediction in APA06410.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	55	295	1.4e-22	0.9131832797427653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.76e-49	22	259	46	268	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	7.88e-23	33	295	14	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA06410.1|GH17	2.91e-223	1	295	1	295
CCD34315.1|GH17	7.23e-185	1	295	1	294
ATZ46547.1|GH17	7.23e-185	1	295	1	294
QSZ35382.1|GH17	6.16e-184	1	295	1	295
VDB89901.1|GH17	2.82e-133	5	295	4	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	6.81e-24	34	290	48	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.81e-23	34	290	48	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	6.77e-67	8	295	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	7.48e-67	8	295	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	2.94e-66	3	295	4	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	5.69e-66	8	295	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	6.53e-65	1	295	1	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000306	0.999636	CS pos: 19-20. Pr: 0.9739

TMHMM  Annotations     

There is no transmembrane helices in APA06410.1.