CAZyme Information: APA05756.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA05756.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
187		18980.79	7.2110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017814:1828572-1829262(-)

Full Sequence      

MTVLFARGTGEVGNVGLLTGPPFFTALAAYMNQTGSMAIQGVDYAASVSGFLSGGDPAGA
KTMAGLINNTLTTCPNTHLTVSGYSQGAQLVHLAMSSLSSTTASRIKSVVMFGDPMNGTA
LNGVDASRVITFCNPKDDICKGKDVILPAHLEYSAYAGMAAMFALSGLADIGITSARKVS
GVGGIMS

Enzyme Prediction     

No EC number prediction in APA05756.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	2	166	1.2e-38	0.9576719576719577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.96e-48	2	168	6	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA05756.1|CE5	1.55e-128	1	187	1	187
ATZ51498.1|CE5	2.11e-107	1	185	90	274
CCD46106.1|CE5	3.31e-98	1	185	84	258
VDB83697.1|CE5	1.25e-52	1	175	76	252
CDJ79835.1|CE5	3.62e-52	1	168	31	197

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	8.03e-40	1	163	82	242	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
4OYY_A	2.92e-21	3	163	22	187	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
5X88_A	4.87e-20	1	153	26	183	Chain A, cutinase [Malbranchea cinnamomea]
4OYL_A	3.33e-19	3	163	22	187	Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens],4OYL_B Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens],4OYL_C Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens]
3GBS_A	2.81e-17	1	168	24	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7G8|CUTI_PYRBR	1.25e-51	1	164	35	197	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|Q00298|CUTI_BOTFU	1.82e-48	1	163	34	195	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	8.46e-44	1	163	34	194	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|A8QPD8|CUTI1_TRIHA	4.47e-40	1	163	82	242	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	3.54e-39	1	163	82	242	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997823	0.002213

TMHMM  Annotations     

There is no transmembrane helices in APA05756.1.