CAZyme Information: APA05670.1

Basic Information

• Species: Sclerotinia sclerotiorum
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
• CAZyme ID: APA05670.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	CP017814|CGC4	33786.88	4.6719

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ssclerotiorum1980UF-70	11368	665079	238	11130

• Gene Location: location=CP017814:1503164-1504313(+)

Full Sequence      

MSLSKIFIAFTGIIAVASSNPLIPRASTACSTSSGPGFCQSTSTSCTNGKYIAGACPGAA
NNQCCVATCSSGQGTCQATSVSCSGGTFKSGLCPGPSDIECCIKSSGSTGSLGFDISQLG
STTFFQCAKKTKDVVVIRGYEQACGSGGQVDSNFVTSYKNAKAAGFTRIDSYLFPCTGTP
TGNEPQCKSISTQISEYLQVISSNNMDITMLWLDIEPTSASTSACNAWNLGAAANEKLAK
QWVAAIKATGLKWGIYANGNQWSGMFASRSTDVGSELPLWAVQDDFEAGVNTVDTFMGGW
TEAVAKQYYLDTTLCGLGVDLDSFS

Enzyme Prediction     

EC	3.2.1.17:5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119378	GH25_Lys1-like	2.90e-67	111	324	1	196	Lys-1 is a lysozyme encoded by the Caenorhabditis elegans lys-1 gene. This gene is one of a several lysozyme genes upregulated upon infection by the Gram-negative bacterial pathogen Serratia marcescens. Lys-1 contains a glycosyl hydrolase family 25 (GH25) catalytic domain. This family also includes Lys-5 from Caenorhabditis elegans.
119373	GH25_muramidase	5.34e-08	113	308	2	168	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
119385	GH25_Lyc-like	8.08e-04	113	324	2	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
119376	GH25_LytC-like	0.005	133	262	24	138	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA05670.1|GH25	6.06e-206	1	325	1	325
ATZ51691.1|GH25	1.75e-172	1	325	1	332
QSZ34056.1|GH25	2.14e-166	1	324	1	331
QNJ46257.1|GH25|3.2.1.17	2.14e-46	113	308	24	211
QNJ46258.1|GH25|3.2.1.17	1.19e-45	113	308	24	211

PDB Hits     

APA05670.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54BL8|LYSG5_DICDI	6.33e-22	112	320	22	211	Probable GH family 25 lysozyme 5 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293566 PE=3 SV=1
sp|Q54BQ8|LYSG4_DICDI	8.14e-21	113	322	22	209	Probable GH family 25 lysozyme 4 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293492 PE=3 SV=1
sp|Q86KC1|LYSG2_DICDI	2.12e-20	113	322	22	209	Probable GH family 25 lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274181 PE=3 SV=1
sp|Q20967|LYS5_CAEEL	5.60e-18	113	322	21	212	Lysozyme-like protein 5 OS=Caenorhabditis elegans OX=6239 GN=lys-5 PE=2 SV=1
sp|Q556R7|CF50_DICDI	5.96e-17	121	324	39	225	Counting factor 50 OS=Dictyostelium discoideum OX=44689 GN=cf50-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000255	0.999705	CS pos: 25-26. Pr: 0.9640

TMHMM  Annotations     

There is no transmembrane helices in APA05670.1.