CAZyme Information: AO090701000770-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090701000770-T-p1
• CAZy Family: GT57
• CAZyme Description: Has domain(s) with predicted catalytic activity, hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909	Chr5_A_oryzae_RIB40|CGC16	100788.42	4.9201

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:331267-334769(-)

Full Sequence      

MASLMKVYKLWVDIIAQNPANRHELTSQQRHVFSAEDPEKPLQDIVTWDEYSILVRGERI
LFFSGEFHPFRLPSPGLWLDVFQKIRALGYSGVSFYLMWGLLEGEPGHVRTEGVFALDGF
FNAASQAGIYLLARPGPYINAEVSGGGFPSWVQRIEGSVRTTDPTFLNATKNYISTIGEI
ISKVQITNGGPVILFQLENEYSICEGAPSHEELNFCLEKDYMAAIEQQFRDAEIVVPFVN
NDAVALGDWAPGTGQGAIDIYGFDNYPFGWGNGYASPENWTQITDPLTQYNFSQHQSMSP
GTPFSIIEFQGGAPDPWGGTGADVCAEMVSNIFARVFYKINYDFRITIFNLYMMLGGTNW
GNLGYSSGYTSYDVGAAIIEDRQITREKYSEIKLEAQFLQVSPAYITSKPHSPCSGCYTN
ASALMTTRLQGESTNFYIIRHSNYIVTQSTSYEWRANTSQGSITVPQPGGSSTLHGRDSK
FHVTDCDLGGINLIYPTAETFTWRRHGSKSVLVLYGGEDEIHEFAVDSNLGNATTIEGSN
VRLGKRGATFVVQWDHLDVYLLWRNEAYQYWVMDLPAPEPLDLHASPSRTNSSVIVKAGY
LLRNASISENTLHLTGDVNATSTVELISAPPGCCSDVLYDGNRLQNISNTNGRVSGVVPY
IDPKLAIPEMESLEWRYLDSLPEGEEKSLYLSTQGGYAYGHSVWLDSTYLGSWQGNPAIQ
NYNQTLQFPQSLQGDEHYVLTILIDNLGLDLNFELNTNTMKSPRGLLDYDLSGHNSWKIT
GNLGGEQYREHSRGPLNKGSTFVERQGYHLSGALNSTKAEWQTRTPQEGLSAAGVGLFAT
TFSLDYPQGYDIPTSVYVTIPTTHQSIVNNTGPQTEYPIPEGILNHHGGNHLAHHLLGSG
RKWGKAGRD

Enzyme Prediction     

EC	3.2.1.23:18	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	54	394	3e-87	0.9804560260586319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	8.84e-90	52	394	1	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	5.12e-61	407	569	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	2.88e-39	405	570	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	3.19e-23	46	208	30	197	beta-galactosidase; Provisional
404273	BetaGal_dom3	1.18e-20	590	655	2	65	Beta-galactosidase, domain 3. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62432.1|GH35	0.0	1	909	1	909
QRD83561.1|GH35	0.0	1	909	1	906
QMW32134.1|GH35	0.0	30	909	16	846
QMW44159.1|GH35	0.0	30	909	16	846
UDD57076.1|GH35	0.0	30	555	7	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	5.13e-287	42	893	2	925	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	2.42e-282	37	893	35	961	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	6.84e-282	37	893	35	961	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	2.99e-281	37	893	35	959	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	2.36e-263	36	890	16	954	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ58|BGALE_NEOFI	2.00e-301	17	893	29	965	Probable beta-galactosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacE PE=3 SV=1
sp|Q4WG05|BGALE_ASPFU	4.57e-300	42	893	38	965	Probable beta-galactosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacE PE=3 SV=1
sp|B0XXE7|BGALE_ASPFC	4.57e-300	42	893	38	965	Probable beta-galactosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacE PE=3 SV=1
sp|Q700S9|BGALA_PENSQ	6.98e-286	37	893	35	965	Beta-galactosidase A OS=Penicillium sp. OX=5081 GN=lacA PE=1 SV=1
sp|A2QAN3|BGALA_ASPNC	1.02e-281	37	893	35	961	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090701000770-T-p1.